KEGG   Drosophila melanogaster (fruit fly): Dmel_CG31613Help
Entry
Dmel_CG31613      CDS       T00030                                 

Gene name
His3:CG31613
Definition
(RefSeq) histone H3
  KO
K11253  histone H3
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    Dmel_CG31613 (His3:CG31613)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG31613 (His3:CG31613)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 318847
NCBI-ProteinID: NP_724345
FlyBase: FBgn0051613
UniProt: P02299
LinkDB All DBs
Structure
PDB: 

Position
2L
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtaccaagcaaactgctcgcaaatcgactggtggaaaggcgccacgcaaacaa
ctggctactaaggccgctcgcaagagtgctccagccaccggaggtgtgaagaagccccac
cgctatcgccctggaaccgtggccttgcgtgaaattcgtcgctaccaaaagagcaccgag
cttctaatccgcaagctgcctttccagcgtctggtgcgtgaaatcgctcaggactttaag
acggacttgcgattccagagctcggcggttatggctctgcaggaagctagcgaagcctac
ctggttggtctcttcgaagataccaacttgtgtgccattcatgccaagcgtgtcaccata
atgcccaaagacatccagttagcgcgacgcattcgcggcgagcgtgcttaa

DBGET integrated database retrieval system