KEGG   Drosophila melanogaster (fruit fly): Dmel_CG32296
Entry
Dmel_CG32296      CDS       T00030                                 

Gene name
Mrtf
Definition
(RefSeq) Myocardin-related transcription factor, isoform G
  KO
K22525  MKL/myocardin-like protein
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    Dmel_CG32296 (Mrtf)
SSDB
Motif
Pfam: SAP RPEL
Other DBs
NCBI-GeneID: 38338
NCBI-ProteinID: NP_001137878
FlyBase: FBgn0052296
UniProt: Q9VZY2
LinkDB
Position
3L
AA seq 1495 aa
MSEGEQRLHATFLGSSDDGNNSDCYDARQSPPKAIVDSSPLQPAMDKNKESLKVKLMVRR
PHSQLVEQGIIPSLKTSPAIHEQCKQLERAKTSDLLKAKIQQRPNREDLERLHILEEDEC
HIDPSLAEKQRMLKKARLADQLNSQIQHRPGPLELIKKNILHTEKPIEKIVKEGLVSFKA
TSEGLLTRPQHPHSYVTFDDDSLSSESDTRQTPPRLDEAMVATSSSPTDVLQAAAASAGI
VTMALTMPTAGQLVVTSPQILPQQQQPKAIVVPAPVPPPPPPPPPLPMASIIKVKQETAN
LYEELCQSVTGTTASPVNHLYSPCSLASSTSTLSPLSSIASPPPPPMTTTRLHLAPVSVK
SDAPGKDKNRKKSKSKPVSKARTIKFHEYKGPPSAAGQKQDQTQPEETSYQLMLEQQNCL
LKFLENLNKNQSIIPAPSAPGVMLPAAPGATNNSITVTTKTVPALASQSAPAPAPISLPN
TISITSSSGGAPLNFGDATMLTPTPAATPTPPTLSLIAAPQQQLQLHQQHQQLHQPTPVQ
HPPPLPSPALSVSSSIPPSPATSYAESTTSSITDLARLEKMKVSDLKQHLKRRNLPVSGP
KPHLIERLKPYLPLEPLDSNVTPAPTSNNSNTTPEVITISDAMDTSNCGLLEQPPPVTML
VSDASMEHEQMDVVQQQMDNTHPMTLQTILPPQPQTATIILTNEELLREQQRKIDELQRQ
LQRSQQELQKIRQRQQQQQHQQQQTVTAQVVNALPSQQITLITTTSNGPQQTLTVMPQQV
EKNFPAKVTVKATGGNSNHKVNGLQQQGSAAKKPASSNSNSNSNISSSNPPPINQKMVVK
QQLEAKIQKQKAAAAAAAQQQQQQQQQQQQQQQQQALQQQQQQQQQQQQVRLLTQKTQTV
FIPFNNNNHINNASAKTTTKKSNVPANNTNTTTATMMQAAKPAAVAAAAASPGNQHHNNL
GLLWNEGNQTILLLGLNDQHMTAHTLGNISLTATTTTTAAPPAATPVAASTIAPPKKILN
GHQRTNSLPSIVFPIETKSIITQQQLQQLQQQQQQQQQFQPVQQPKQQQLNQVDIKPAPA
PPPQYEEATKQLAASKAAALNGLLPLVKIKEEPVQSPAPSAAPLPQTAPLCKRKTASIKS
EQVSDVLDILIKQGELPESAALEPITPLTPLPELSMFNGATPTTAAGGASIVPLVPKLET
PVTPVQNLDVAMDTNVQHVGFASNQAPNHVFIESIDMASPLQTDSSAIDAESVAKTLDIF
LEQHHATPPPSTPPKSCHSGSEKPNSPDAKLNHFDEYELLELMSQQLEMDMGDDSSGYCH
ASAAKSSNNNGNLRRDLNPSLQPSINELLDASSPDNVLLNNNTGADVDFDADSFVAQLSQ
HVTGNGNSPGVNCNGSIESSSSAVNSHFGSHSTPMDCDDFESTLNSFMQAVTQPQAGQHV
EYATSTSMANGTGGGMGVDNGTGGAVDAFNASGDIFDLFNMDDYKMNWAAGDFTV
NT seq 4488 nt   +upstreamnt  +downstreamnt
atgtcggagggtgagcagcgtttgcatgcgacgttcctgggcagcagcgatgatggcaac
aactcggattgttacgatgccagacagtcaccaccaaaggccatcgtggactccagtccg
ctgcagccagcgatggacaagaataaggaatcgctcaaagtgaagctcatggtgcgacgt
ccacactcgcagctcgtcgagcagggcatcataccatctctgaaaacctcgcccgctatc
cacgaacaatgcaagcaactggagcgcgccaagaccagcgatctgctgaaggcgaagatc
cagcagcgaccgaatcgcgaagatctcgagaggctgcacattctcgaggaggacgagtgc
cacatcgatcccagtttggcggagaagcaacggatgctgaagaaggctcgcctagcggac
cagctcaactctcagattcaacaccgtcctggtccactggagctaatcaaaaagaacatc
ctgcatacggagaagccgatcgagaagatagtcaaggagggactcgtatccttcaaggca
accagcgagggcctgctcacgaggccgcagcatccgcacagttatgtgaccttcgatgat
gattccctgagctcagagagcgatacaaggcagacaccgccgcgtttggatgaggctatg
gttgccacctctagttcacccaccgatgtactgcaggcggcggctgcctcggcgggaata
gtgaccatggcattgaccatgcccacagctggtcaactggtggtcacctcgccacagatt
cttccccagcagcagcaaccgaaggctatagtggtgccagcaccagtgccaccacctccg
ccgccaccaccaccactgcccatggccagtatcatcaaggtgaagcaggagacggccaat
ctgtacgaggaactctgccaaagtgttactggtactacggcaagtccggtcaatcatctg
tactcgccctgctccctagcctctagtacttccacactaagtccgctgtcttccatcgcc
tctccgccaccaccaccgatgaccaccacacgactgcaccttgctcccgtgtccgtgaag
tctgatgctcccgggaaggataagaaccgtaagaaatccaagtccaagcccgtgtccaag
gcgcgcaccattaaattccacgagtacaagggtccaccgagtgccgccgggcaaaagcag
gatcaaacgcagccggaagagacctcctaccagctgatgttggagcagcaaaactgtctg
ctaaagttcctggagaacctcaacaagaatcagtccatcatcccagcgcccagtgcgccg
ggtgttatgcttccagcagctcctggtgcgaccaataacagcattacggttactacaaag
acggtgccagcattggcctcgcaatccgctccagctccagctcccatcagcctgcccaat
accatatccataacgagcagttccggaggagccccacttaattttggagatgccaccatg
ttgacgcccacgccggcggccacacccacaccgcccactctgtcgctgatcgctgcacca
caacaacagttgcagctgcatcagcaacaccagcagctgcaccaaccaactccagtgcaa
cacccaccaccactgccctcgccagcgctttcggtcagctcctcgattccgcccagtccg
gccaccagctacgccgaatccaccaccagttccatcacagacttggcccgactggagaag
atgaaggtctctgacctaaagcagcatctcaagcgcaggaacttgcccgtttccggtcct
aaaccacatctgattgagaggctgaaaccgtatctgcccctggagccactggatagcaat
gtaacacccgctccgacctccaacaacagcaacaccacgcccgaggtgatcacaattagc
gatgcgatggacacgagcaactgcggtttgttggagcagcctccaccggtgaccatgttg
gtttcagatgcaagcatggagcacgagcagatggatgtggtgcagcaacagatggataac
acacatccaatgacgctgcagaccattctgcctccacaaccgcaaactgcaaccataatc
ctgaccaacgaggaattgctgagggagcagcagcgcaagatcgacgagttgcagaggcaa
ttgcagcgatcgcaacaggaactgcagaagatacgccagcggcaacagcagcagcaacat
cagcagcagcagacggttaccgctcaagtggtgaatgcattgccttcgcagcaaatcacg
ctgatcaccacgacctcgaatgggccgcagcaaacactgactgtaatgccgcagcaagtg
gagaagaattttcccgccaaagtgacagtgaaagctactggaggcaatagcaaccataag
gtaaatggactgcaacaacagggatccgcagccaagaagccagccagcagcaactcgaac
agcaatagtaacatttcctcatcgaatccgccaccaatcaaccagaaaatggtggtcaag
cagcagctggaggctaaaatccagaagcaaaaggcagcggcagcagccgccgcacagcaa
cagcagcagcagcaacaacaacaacaacagcagcagcagcagcaggcactgcagcaacag
caacaacagcagcagcaacagcaacaggtgcgcctgctcacgcaaaagacacaaactgta
ttcattccattcaacaacaacaatcacataaataacgcttctgccaagacaacgaccaag
aaatccaatgtgcccgccaacaatacaaatacaaccaccgcaaccatgatgcaagcagcc
aagccggcggcagttgcggcggcagcagcctcgccaggcaatcaacaccacaataacttg
ggcctgctgtggaacgaaggaaatcagaccatactactgctgggtctgaatgatcagcac
atgacggcgcacacgctgggcaatatcagcttgacggccaccaccacgacaacagcagca
ccgccagcggctactccagttgcagcatctacgatagctccgccaaagaagatactgaat
ggccaccaacgcacaaactccctgcccagcattgtctttcccatcgaaaccaagtccatc
attacacagcaacagttgcaacaactccagcagcaacaacagcagcaacagcaattccag
cctgtccagcagccaaagcagcagcaactcaaccaagtggacatcaagcccgcaccagca
ccaccgccgcagtacgaagaggccactaagcagctggcggccagtaaggcggcagcattg
aatggcctcctaccgctggtcaagattaaagaggagcccgttcagtcgcccgctcctagt
gcagctcctctgccgcagacagctcctctgtgcaaacgcaagacggcaagcattaagtcc
gaacaagtcagcgatgttctggacatactaatcaagcagggtgaactgccggaaagtgct
gctctggagcccattacaccgctgacgccgctgcccgagttgtccatgttcaatggagcc
acgcccaccactgcggctggtggagccagcatagtaccgctggtgcccaagctggagacg
ccagtcacgccagtccaaaacctcgacgtggccatggacacaaatgtgcagcatgtaggc
ttcgccagcaatcaggccccgaatcatgtgttcatcgagagcatagacatggcctcgccc
ctgcagaccgattcaagcgccattgatgctgagagcgtggccaagaccttagatattttc
ctagagcagcatcatgccacgccgccaccgagcacaccgcccaaaagttgccacagcggt
agtgaaaagccaaacagcccggatgccaagctcaatcactttgatgagtacgagctgctg
gagcttatgtcgcagcaacttgagatggacatgggagatgactccagtggctattgtcac
gcctcggcggcgaagagtagcaacaacaacggcaacctgcgacgcgatctcaatcccagc
ctgcagccgtccatcaatgagctgctggatgcgagcagtccggacaacgtgctgctgaac
aataacacgggtgccgatgtggacttcgacgcggatagctttgtggcccaactgagtcag
cacgtcactggaaatggcaacagtcctggggtcaattgcaatggatccattgaatcctcg
tcgtcggcggtgaatagtcactttgggagccacagcacaccaatggattgcgatgatttc
gagagtacactcaactcttttatgcaggcggtgacccaaccgcaggcgggccaacacgtc
gaatacgcgacgtcgacgagcatggccaatggaaccggaggaggaatgggcgtggacaac
ggcaccggtggggcagtggacgccttcaatgctagtggcgatatattcgatctgttcaac
atggacgattacaagatgaactgggcggcgggagattttacagtctag

DBGET integrated database retrieval system