KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3271Help
Entry
Dmel_CG3271       CDS       T00030                                 

Gene name
PGAP3
Definition
(RefSeq) Post-GPI attachment to proteins 3, isoform A
  KO
K23553  post-GPI attachment to proteins factor 3
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG3271 (PGAP3)
Membrane trafficking [BR:dme04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Post-GPI attachment to proteins factors (PGAP)
    Dmel_CG3271 (PGAP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Per1 Kei1
Motif
Other DBs
NCBI-GeneID: 35570
NCBI-ProteinID: NP_724485
FlyBase: FBgn0033088
UniProt: Q7K0P4
LinkDB All DBs
Position
2R
AA seq 326 aa AA seqDB search
MSSRSLSAIVLLLGALVTACLASNGDRTQFFHNCRQNCERTNCSADGLEIQEQAVKFYQQ
SVFDRLFQWSCADECQYGCMWRTVFAFFERGWPIPQFYGKWPFLRLLGMQEPASVIFSCL
NFVVHLRLLRKFRREVRPDSPCYMLTHIFAVTSLNGWIWSAIFHTRDFPLTELLDYAFAY
SIILCSLYVMVMRMLHRYSLFLRGVITLAFLSYYINYFAYLSVGRFNYAFNMMVNVATGV
IAAVGWFVWCHFVRTRRPYFRRILRFYILMALAMSLELLDFPPILWILDAHALWHLATIP
LASLYYECVEILLYSNIATCVCILAS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtcgtagtttaagtgcaatagtcttgctccttggggcgttagtgaccgcctgc
ctcgcctccaacggcgaccgcacacagttttttcacaattgccgacagaactgcgagcga
acgaactgctcggcagatggactggagatccaggagcaggcagtcaagttttaccagcag
tcggtgtttgaccggctcttccagtggagctgcgcggacgagtgtcagtatggatgcatg
tggcgaacggtgttcgccttctttgaacgcggttggccgattccccagttctacggcaag
tggccctttctccgcctgctgggcatgcaggagccggcctcagttatcttctcctgcctg
aattttgtcgttcacctgcgcttgttacgcaagttccgccgagaagtgcgtccggacagt
ccctgctatatgctgacccacatattcgcagtgacgagtctcaacggctggatctggtcc
gccatctttcacacaagggactttccactgaccgagctgctggactacgcctttgcctat
tccatcatcttgtgctcactttacgtcatggtcatgcggatgctgcaccgctactcgctg
ttcctacggggtgttatcacgttggcattcctctcctactacattaactactttgcctac
ctgagcgtgggacggttcaactatgcgttcaacatgatggtaaacgtggctacgggagtt
atagcggcagtgggatggttcgtttggtgtcactttgtgcgcacccgcaggccctacttt
agaaggatcctgcgtttctatattctcatggcgttggctatgagccttgaactgcttgac
tttccgcccatcctctggattctggatgctcatgctctgtggcacttggcaacaattcct
ctggcatccctatactatgagtgcgtagaaatattactttattctaatattgctacatgt
gtttgcattttagcttcatga

DBGET integrated database retrieval system