KEGG   Drosophila melanogaster (fruit fly): Dmel_CG32849Help
Entry
Dmel_CG32849      CDS       T00030                                 

Gene name
Hex-t2
Definition
(RefSeq) Hex-t2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00010  Glycolysis / Gluconeogenesis
dme00051  Fructose and mannose metabolism
dme00052  Galactose metabolism
dme00500  Starch and sucrose metabolism
dme00520  Amino sugar and nucleotide sugar metabolism
dme01100  Metabolic pathways
dme01200  Carbon metabolism
Module
dme_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dme_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dmel_CG32849 (Hex-t2)
   00051 Fructose and mannose metabolism
    Dmel_CG32849 (Hex-t2)
   00052 Galactose metabolism
    Dmel_CG32849 (Hex-t2)
   00500 Starch and sucrose metabolism
    Dmel_CG32849 (Hex-t2)
   00520 Amino sugar and nucleotide sugar metabolism
    Dmel_CG32849 (Hex-t2)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dmel_CG32849 (Hex-t2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG32849 (Hex-t2)
Enzymes [BR:dme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Dmel_CG32849 (Hex-t2)
Membrane trafficking [BR:dme04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Dmel_CG32849 (Hex-t2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 43191
NCBI-ProteinID: NP_733151
FlyBase: FBgn0042710
UniProt: Q9NFT7
LinkDB All DBs
Position
3R
AA seq 486 aa AA seqDB search
MRKSTRLLTHSLFGPVFKILFHNKTVCGGCNRKMPSLVNTEIEAAVKGFLIDQEKMTEVV
ERMTKEIKMGLAKDTHARAVIKCFVSHVQDLPTGKERGKYLALDLGGSNFRVLLVNLISN
SDVETMSKGYNFPQTLMSGSGKALFDFLAECLSEFCHSHGLENESLALGFTFSFPLQQQG
LSKGILVAWTKGFSCEGVVGKNVVSLLQEAIDRRGDLKINTVAILNDTVGTLMSCAFYHP
NCRIGLIVGTGSNACYVEKTVNAECFEGYQTSPKPSMIINCEWGAFGDNGVLEFVRTSYD
KAVDKVTPNPGKQTFEKCISGMYMGELVRLVITDMIAKGFMFHGIISEKIQERWSFKTAY
ISDVESDAPGEYRNCNKVLSELGILGCQEPDKEALRYICEAVSSRSAKLCACGLVTIINK
MNINEVAIGIDGSVYRFHPKYHDMLQYHMKKLLKPGVKFELVVSEDGSGRGAALVAATAV
QAKSKL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtcaactagacttttaactcattctctattcggccctgtatttaaaattttg
tttcataacaaaacagtttgtggaggctgtaataggaaaatgccgagcctggtgaacacg
gaaattgaagccgcggtcaagggcttcctgatcgaccaggagaagatgaccgaggtggtg
gagcgcatgaccaaggagataaagatgggcctggccaaggacacgcatgcacgagcggtg
atcaagtgcttcgtcagccatgtgcaagatctgcccactggcaaggagcggggaaagtat
ttggccctggatctgggtggctctaatttcagggtgcttctggtgaacctgattagcaac
tcggacgtggaaaccatgtcgaagggctataattttcctcaaactctgatgtccggatcg
ggaaaggcgcttttcgacttccttgccgaatgcctgtcggagttttgtcactcccatggc
ctggagaatgaatcactggctctgggcttcaccttctcgtttccgctccagcagcaggga
ctctccaagggtatccttgtggcctggaccaaaggattcagctgcgaaggcgtggtgggc
aagaatgtggtgagtcttctccaggaggcaatcgatcgaaggggcgatctaaagatcaat
accgtcgccattctcaacgatacggtgggcactctgatgtcctgcgccttctatcatccc
aactgccggattggattgatcgtgggaaccggctccaatgcgtgctatgtggagaaaaca
gtaaatgccgaatgcttcgaaggataccagaccagtcccaagccatcaatgataatcaac
tgcgagtggggcgcctttggggacaatggtgttctggagttcgttcgaacttcctacgac
aaggcagtcgacaaggtaacacccaatcccggcaagcagacgttcgaaaagtgcatatcg
ggcatgtatatgggtgaacttgtacgtttggtcatcaccgatatgattgccaagggtttt
atgttccacggcatcatttccgagaagatccaggagcgatggagcttcaaaaccgcctat
atttccgatgttgaaagtgatgcacctggcgagtatcgcaattgcaataaggtccttagc
gaattgggcatattgggctgccaggaacccgacaaagaggccctgcgatacatctgcgag
gcggtgtcctccaggtctgccaagctatgtgcctgcggcctggtcaccattatcaacaag
atgaacatcaacgaggtggccatcggcatagacggtagcgtgtatcgcttccatcccaag
taccacgacatgctccagtaccacatgaagaagctcctcaagccgggcgtcaagtttgag
ctggttgtttcggaggacggatccggaagaggagcggctctcgtggcggccaccgcagtc
caggccaaaagcaagctctaa

DBGET integrated database retrieval system