KEGG   Drosophila melanogaster (fruit fly): Dmel_CG33528
Entry
Dmel_CG33528      CDS       T00030                                 

Gene name
Vmat
Definition
(RefSeq) vesicular monoamine transporter, isoform C
  KO
K08155  MFS transporter, DHA1 family, solute carrier family 18 (vesicular amine transporter), member 1/2
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG33528 (Vmat)
Transporters [BR:dme02000]
 Solute carrier family (SLC)
  SLC18: Vesicular amine transporter
   Dmel_CG33528 (Vmat)
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    Dmel_CG33528 (Vmat)
SSDB
Motif
Pfam: MFS_1 Sugar_tr MFS_3
Other DBs
NCBI-GeneID: 3346192
NCBI-ProteinID: NP_001014524
FlyBase: FBgn0260964
UniProt: Q86NW1
LinkDB
Position
2R
AA seq 610 aa
MQSSTDAGNGGPRKHTQSTAPQKQSEISETTSFTVNANTTTNSQQQQIPGGPASNTPSKN
PFKQQLDSNQQNGNMEPDCGIMGVGKEPPVPPPPTYQSQTYAGRQAPPPADQYREEDPRA
AGSWAAAKSWMVSWRGSNRLVLVIVAIALLLDNMLLTTVVPIIPEFLYDIRHPDAPLDSF
PRTPLTSNVPPPPTPCPCNKDGSEAAPLEISTISPEENETYYRELEERHNELVGETVEVG
LLFASKAFVQLLVNPIVGPLTHRIGYSIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQ
GIGSSCSSVSGMGMLADRFTDDKERGNAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPF
LILAALALGDGLLQLFMLQPSIQKAETEPPSLKSLISDPYILIAAGAITFANMGIAMLEP
SLPLWMVDNMGATRWEQGVAFLPASISYLIGTNLFGPLGHKIGRWFAACLGLIIIGGCLI
FIPMATSITHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYALGDVAFCVGF
AVGPALSGSLVKSIGFEWMLFGIAILCFMYAPLLTLLKNPPTSDEKKSLIYGRDRAQVRY
VTYQNYEEDE
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgcaatcatcgaccgatgcgggcaatggtggaccaagaaaacacacgcagagcacagcc
ccccagaagcagtcggagattagcgagaccacctccttcaccgtaaacgcaaacaccacc
accaacagccagcagcaacagattcccggcggacccgccagcaatacgcccagcaaaaat
cccttcaagcagcagttggacagcaatcaacagaatggcaatatggagccggattgcggc
atcatgggcgtcggcaaggagccaccggtaccgccgccgcccacctaccagtcgcagacc
tacgcaggacgacaggctccgccgccagcggatcagtaccgcgaggaggatccacgcgct
gccgggtcctgggccgccgccaaatcctggatggtcagctggcggggatccaatcgcctg
gtgctcgtcatcgtggccatagccctgctcctcgacaacatgctgctgaccacagtggtg
cccatcatacccgagttcctgtacgacatacgacatccggatgcgccgctcgacagcttt
ccacgcacacctttaacgtccaacgttccgccgccaccgacgccgtgtccatgcaacaag
gatggcagcgaggcggctccgctcgagatctccacgattagtccggaggagaacgagacc
tattaccgggaactggaggagcggcacaacgagctggtgggcgagaccgtcgaggtggga
cttctatttgcctccaaggcgtttgtccagctgctggttaacccaattgttggacccctg
actcacaggattggctatagtattcccatgttcgctggctttgtgataatgttcctctca
acgataattttcgcttttggacgatcttacctggtactgttcgtggcgagggcactgcag
ggcattggatcatcctgctcctcggtttccggaatgggcatgctggcagatcgatttacg
gacgacaaggagcgtggaaatgccatgggcatagcactgggaggattggctttgggcgtg
ctcatcggtccaccattcggtggcgtgatgtacgagtttgtgggcaagtcggctccattc
ctgatcctggctgccctggccttgggcgatggcctgctacagttgttcatgctgcagcca
tcgatccagaaggccgaaacggaaccgccctcgctgaagagcctcatcagtgatccctac
atcctgattgctgctggtgccatcacgttcgccaatatgggcattgccatgctggaacca
tcgctaccgctgtggatggtggacaacatgggcgccactcgttgggagcagggcgtggcc
ttcctgcccgcctccattagctacctgattggcaccaatctcttcggaccgctgggacac
aaaattggacgatggtttgccgcgtgcttgggattgattatcatcgggggatgcttgata
tttatacccatggccacttcgatcactcacctgatcatcccgaatgcaggacttggcttt
gccattggaatggtggactcgtcgatgatgccggaactgggctatctggtggacatccga
cactcggcggtctacggcagcgtttacgccctgggtgatgtggccttctgtgttggcttc
gccgtgggtcccgccttatctggatcgctggtgaagagcatcggcttcgagtggatgttg
tttggaattgccatactctgctttatgtatgctccattgctgacgctgctcaagaatccg
ccgaccagcgacgagaagaagtctttgatctatggacgcgatcgggctcaggtacgttat
gtaacctatcaaaactacgaggaagacgaataa

DBGET integrated database retrieval system