KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3401Help
Entry
Dmel_CG3401       CDS       T00030                                 

Gene name
betaTub60D
Definition
(RefSeq) beta-Tubulin at 60D, isoform A
  KO
K07375  tubulin beta
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04145  Phagosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    Dmel_CG3401 (betaTub60D)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     Dmel_CG3401 (betaTub60D)
Cytoskeleton proteins [BR:dme04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    Dmel_CG3401 (betaTub60D)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG3401 (betaTub60D)
  Exosomal proteins of colorectal cancer cells
   Dmel_CG3401 (betaTub60D)
  Exosomal proteins of bladder cancer cells
   Dmel_CG3401 (betaTub60D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_2 Tubulin_3 TrmK
Motif
Other DBs
NCBI-GeneID: 37888
NCBI-ProteinID: NP_523842
FlyBase: FBgn0003888
UniProt: P08841
LinkDB All DBs
Position
2R
AA seq 454 aa AA seqDB search
MREIVNLQAGQCGNQIGAKFWEIISEEHGIDSNGIYVGDSDLQLERVSVYYNEASAVTRS
SGGKYVPRAILLDLEPGTMESVRSGPYGQLFRPDNFVYGQSGAGNNWAKGHYTEGAELVD
NVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPK
VSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKVSNPSYGDLNHLVSLTMS
GVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMF
DAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLAVQNKNSSYFVEWIPNNVKTAVC
DIPPKGLKMSSTFIGNTTAIQELFKRISEQFSAMFRRKAFLHWYTGEGMDEMEFTEAESN
MNDLVSEYQQYQEATADDEFDPEVNQEEVEGDCI
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaatcgtgaacctgcaggccggccagtgcggcaaccaaatcggcgctaagttc
tgggagatcatttccgaggagcacggcatcgacagcaatggcatctacgtgggcgacagt
gatctgcagctggagcgcgtcagtgtctactacaacgaagcatcggcagtcacgcggtcg
tcgggtggcaagtacgtgcccagggccatcctgctcgatctggagcccggaaccatggag
tcggtgcgttccggtccgtacggacaactcttccggccggacaacttcgtgtacggacag
tcgggagcgggcaacaactgggccaagggtcactacaccgagggcgccgagctggtggac
aatgtcctggacgtggtccgcaaggagtgcgagaactgcgactgcctgcagggcttccaa
ttgacgcactcgctgggcggcggcactgggtccggaatgggcaccctgctgatctcgaag
atccgcgaggagtaccccgaccgcatcatgaacacctactcggtggtgccatcgcccaag
gtgtcggacaccgtggtggagccctacaacgccaccctgtcgatccaccagctggtggag
aacacagacgagacgtactgcatcgacaacgaggcgctgtacgacatctgcttccggacg
ctgaaggtgtcgaatcccagctacggagacttgaaccacctggtctcgctgaccatgtcc
ggggtgaccacctgcctgcgtttccccggccagctgaacgccgatctgcgcaagctggcg
gtcaacatggttccattcccgcgtctccacttcttcatgcccggattcgcgccgctcacc
tcgcgcggatcgcagcagtaccgcgccctcaccgttcccgaactgacccagcagatgttc
gacgccaagaacatgatggccgcctgtgatccacgccacggtcgctacctcacggtggcc
gccgtcttccgcggccgcatgtccatgaaggaggtggacgagcagatgctggcggtgcag
aacaagaacagctcctacttcgtggagtggatcccgaacaatgtgaagaccgcggtgtgc
gacatcccgccgaagggcctgaagatgtcctcaacgttcatcggcaacaccacggccatc
caggagctgttcaagcggatctccgagcagttctcggccatgttccggcgcaaggccttc
ctgcactggtacaccggcgagggcatggacgagatggagttcaccgaggcggagagcaac
atgaacgacctggtgtccgagtaccagcagtaccaggaggccaccgccgacgacgagttc
gacccggaggtcaatcaggaggaggtcgagggcgattgtatttaa

DBGET integrated database retrieval system