KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3874Help
Entry
Dmel_CG3874       CDS       T00030                                 

Gene name
frc
Definition
(RefSeq) fringe connection, isoform B
  KO
K15281  solute carrier family 35
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG3874 (frc)
Transporters [BR:dme02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   Dmel_CG3874 (frc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPT
Motif
Other DBs
NCBI-GeneID: 39943
NCBI-ProteinID: NP_001137962
FlyBase: FBgn0042641
UniProt: Q95YI5 B7Z066
LinkDB All DBs
Position
3L
AA seq 373 aa AA seqDB search
MSMSRGGNTTLDLQPLLAESDVGNRELEEKMGGSADRSSLLDGSGSKELSHREREDSALF
VKKIGSALFYGLSSFMITVVNKTVLTSYHFPSFLFLSLGQLTASIVVLGMGKRLKLVNFP
PLQRNTFAKIFPLPLIFLGNMMFGLGGTKTLSLPMFAALRRFSILMTMLLELKILGLRPS
NAVQVSVYAMIGGALLAASDDLSFNMRGYIYVMITNALTASNGVYVKKKLDTSEIGKYGL
MYYNSLFMFLPALALNYVTGNLDQALNFEQWNDSVFVVQFLLSCVMGFILSYSTILCTQF
NSALTTTIVGCLKNICVTYLGMFIGGDYVFSWLNCIGINISVLASLLYTYVTFRRKRAPD
KQDHLPSTRGENV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgagtatgtcgcgcggcggcaacacaactctggacttgcagccgctcctggcggagagc
gatgtcggaaacagggagctggaggagaagatgggcggatcggcggatcggtcatcgctg
ctcgatggatccggttcgaaggagctgagtcaccgggaacgcgaggactcggcgttgttc
gtcaagaagatcgggagcgccttgttctatggcttgtcctccttcatgattacggtggta
aacaagacggtgcttacctcctaccacttcccctcgttcctgttcctcagcctcgggcaa
cttactgctagcattgtggtcctgggcatgggcaagcgcctgaaattggtgaactttccc
cctctgcagaggaataccttcgccaagatctttccgctgccactgatatttctgggaaac
atgatgtttggactgggtggcacaaaaaccttgagtctgcccatgttcgcagccctacga
cgcttctctatcctgatgaccatgctgctggagctcaagatcctgggactgcgaccttcg
aatgcggttcaggtcagcgtatacgcaatgatcggtggagcgctgctggccgcctctgat
gatctgtccttcaacatgaggggctacatctatgtgatgatcactaacgccttgaccgcc
tcgaatggcgtatatgtgaagaaaaaactcgacacctcggagatcggaaagtacggccta
atgtactacaactcgctgtttatgtttctgcctgccctggccctcaactatgttacaggg
aatctagatcaggcgctgaactttgaacaatggaatgactcagtgtttgtggtgcagttc
ctgctcagttgcgttatgggtttcatcctatcgtacagcaccatcctgtgcacgcaattc
aactcggcgctgaccaccaccattgtgggatgcctgaaaaacatctgcgtaacatatctg
ggcatgttcattggaggcgactacgtcttctcgtggctcaactgtattgggatcaacatc
agcgtgctggctagtctgctctacacgtacgtcacttttcggcggaagcgggctcccgat
aagcaggaccacttgcccagcacccgcggcgagaatgtctag

DBGET integrated database retrieval system