KEGG   Drosophila melanogaster (fruit fly): Dmel_CG3954
Entry
Dmel_CG3954       CDS       T00030                                 

Gene name
csw
Definition
(RefSeq) corkscrew, isoform A
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG3954 (csw)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dme01009]
    Dmel_CG3954 (csw)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     Dmel_CG3954 (csw)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    Dmel_CG3954 (csw)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Ribosomal_S17e Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 45278
NCBI-ProteinID: NP_477130
FlyBase: FBgn0000382
UniProt: P29349
LinkDB
Position
X
AA seq 841 aa
MSSRRWFHPTISGIEAEKLLQEQGFDGSFLARLSSSNPGAFTLSVRRGNEVTHIKIQNNG
DFFDLYGGEKFATLPELVQYYMENGELKEKNGQAIELKQPLICAEPTTERWFHGNLSGKE
AEKLILERGKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMIRWQDKKYDVGGGESFGTLS
ELIDHYKRNPMVETCGTVVHLRQPFNATRITAAGINARVEQLVKGGFWEEFESLQQDSRD
TFSRNEGYKQENRLKNRYRNILPYDHTRVKLLDVEHSVAGAEYINANYIRLPTDGDLYNM
SSSSESLNSSVPSCPACTAAQTQRNCSNCQLQNKTCVQCAVKSAILPYSNCATCSRKSDS
LSKHKRSESSASSSPSSGSGSGPGSSGTSGVSSVNGPGTPTNLTSGTAGCLVGLLKRHSN
DSSGAVSISMAEREREREREMFKTYIATQGCLLTQQVNTVTDFWNMVWQENTRVIVMTTK
EYERGKEKCARYWPDEGRSEQFGHARIQCVSENSTSDYTLREFLVSWRDQPARRIFHYHF
QVWPDHGVPADPGCVLNFLQDVNTRQSHLAQAGEKPGPICVHCSAGIGRTGTFIVIDMIL
DQIVRNGLDTEIDIQRTIQMVRSQRSGLVQTEAQYKFVYYAVQHYIQTLIARKRAEEQSL
QVGREYTNIKYTGEIGNDSQRSPLPPAISSISLVPSKTPLTPTSADLGTGMGLSMGVGMG
VGNKHASKQQPPLPVVNCNNNNNGIGNSGCSNGGGSSTTSSSNGSSNGNINALLGGIGLG
LGGNMRKSNFYSDSLKQQQQREEQAPAGAAKFKNIPKDMIGLRPPSHAPALPPPPTPPRK
T
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgtcatcgcgaagatggttccacccaacgatatctggcatcgaagctgagaaactgctg
caggagcagggattcgacggctccttcctcgcccgcctctcctcctcgaatccgggcgcc
ttcacgctctccgtgcgccgcggcaacgaggtgacccacatcaaaatccaaaacaatggc
gacttctttgatctctacggtggtgaaaagttcgccacactgccggaactggtacaatac
tacatggagaatggcgagctaaaggagaagaacggccaggccatcgaactcaagcagccg
ctgatctgcgccgagcccaccacggaaagatggtttcatggcaatctttccggaaaggaa
gcggaaaaattgatcctggagcggggcaagaatggttcgtttctcgtccgtgaatctcag
agcaagcctggcgacttcgtcctttccgtgcgcacggacgacaaagtaacgcatgtcatg
attcgatggcaggacaagaagtacgacgtcggcggcggggaatcctttggcaccttgtcg
gaactgatcgatcactacaagcgtaatcccatggtggagacgtgcggaaccgtggtgcat
ctgcgacagccattcaacgccacacgaatcacggcggccggcatcaatgcccgggtggaa
cagctggtcaagggaggtttctgggaggaattcgaatcgctgcaacaggacagtcgggac
acattctcgcgcaacgagggctacaaacaggagaaccgcctcaagaatcgctaccgcaac
atattgccatacgaccacacgcgcgtcaagctgctggacgtggagcatagcgtggccgga
gccgagtacatcaatgccaactacatacggctgcccaccgacggcgacctgtacaacatg
agcagctcgtcggagagcctgaacagctcggtgccctcgtgccccgcctgcacggctgcc
cagacacagcggaactgctccaactgccagctgcaaaacaagacgtgcgtgcagtgcgcc
gtgaagagcgccattctgccgtatagcaactgtgccacctgcagccgcaagtcagactcc
ctgagcaagcacaagcggagcgaatcctcggcctcttcatcgccctcctccggctctggg
tccggaccaggatcgtcgggcaccagcggagtgagcagcgtcaatggacccggcacaccc
accaatctcacgagcggcacagccggatgtctggtcggcctgctgaagagacactcgaac
gactcgtccggagctgtttctatatcgatggccgaacgggaacgcgagagggagcgcgag
atgtttaagacctacatcgccacccagggctgtctgctcacccagcaagtgaacacggtg
acggacttctggaacatggtctggcaggagaacacgcgggtgatcgtcatgaccaccaag
gagtacgagcgcggcaaagaaaagtgcgcccgctactggccggacgagggtagatcggag
cagttcggccacgcgcggatacagtgcgtctcggagaactcgaccagtgactatacgctg
cgcgagttcctcgtctcgtggcgggatcagccggcgcgccggatctttcactaccatttc
caggtgtggccggatcacggagtgcccgccgatccgggctgtgtgctcaacttcctgcaa
gatgtcaacacgcgtcagagtcacctggctcaagcgggcgagaagccgggtccgatctgc
gtgcactgctctgcgggcatcggtcgcactggcacctttattgtgatcgatatgattctc
gatcagattgtgcgcaatggattggatactgaaatcgacatccagcgcaccattcagatg
gtccgatcgcagcgttccggtcttgtgcaaaccgaggcgcaatacaagttcgtctactat
gcggtgcagcactatatacagaccctgatcgcccggaaacgagctgaggagcagagcctg
caggttggccgcgagtacaccaatataaagtacacgggcgaaattggaaacgattcacaa
agatctccattaccaccagcaatttctagcataagtttagttccgagtaagacgccactg
acgccgacatcggcggatttgggcactgggatgggcctaagcatgggcgtgggcatgggc
gtcggcaacaagcacgcatcgaagcagcagccgccgttgccggtggtcaactgcaacaat
aataacaacggcattggcaatagcggctgcagcaacggcggcgggagcagcaccaccagc
agcagcaacggcagcagcaacggtaacatcaacgccctactgggcggcatcggcttgggg
ctgggcggcaatatgcgcaagtcgaacttttacagcgactcgctgaagcagcaacagcag
cgcgaggagcaggctccggcgggagcagcaaaattcaaaaacattcccaaagacatgatc
ggcttgcgaccgccaagccatgcgcctgcgttgccgccgccaccgacaccgccgcgcaaa
acatga

DBGET integrated database retrieval system