KEGG   Drosophila melanogaster (fruit fly): Dmel_CG42250
Entry
Dmel_CG42250      CDS       T00030                                 

Gene name
lqfR
Definition
(RefSeq) liquid facets-Related, isoform C
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: ENTH ANTH SCIMP GRP DUF5677
Other DBs
NCBI-GeneID: 42632
NCBI-ProteinID: NP_732734
FlyBase: FBgn0261279
UniProt: Q9VD13
LinkDB
Position
3R
AA seq 649 aa
MVDKFISMWKVRELADKVTNVVMNYTETEGKVREATNDDPWGPTGPLMQELAYSTFSYET
FPEVMSMLWKRMLQDNKTNWRRTYKSLLLLNYLVRNGSERVVTSSREHIYDLRSLENYTF
TDEGGKDQGINVRHKVRELIDFIQDDDRLREERKKAKKNKDKYIGMSSDAMGMRSGGYSG
YSGGSGGGGGGSGGYNDGDYRSSRGDNWYSDKSADKDRYEDDDTHYDGEREGSDSDSPSP
RRNYRYNDRASPAEVASEAKPSSLNMNIRSKTVSSPVSKQPTSTASAKPALSQKKIDLGA
AANFGKPAPGGAAGIHSPTHRDTPTSVDLMGGASPSPSTSKANNNTQSNNNDLLDDLFKT
CSPPPGQEKTLNSAAVIVDDDDDFNPRASDASQQEFGDFASAFGQPSAGSTISEPPSTGL
VPAANDEFADFAAFQGSTTSTSALDGNLLKTATPANDSFDLFNSAPTSTAAATTATDLLA
GLGDLSIHQSMPMDNMMPPIPAVTGNNLLQPMSVTNNNNNTNGGAVPAAASVQSTAVGAT
WSGDLKGGKMNIDLDNLLMSKSGKPSAPAPSMNALKTNSPAKAPLNVQTGGGFPGLSPMT
SPNIFGAPAPQQSIPQNQSAFANFGAFQQQQQNHSNNNNNSSSAFDLFQ
NT seq 1950 nt   +upstreamnt  +downstreamnt
atggtggataaattcatcagcatgtggaaagtgcgcgaattggcggacaaggtcaccaat
gtcgtgatgaattacacggaaacggagggcaaggtgcgggaggccaccaacgatgatcct
tgggggcctacaggacccctcatgcaggaattggcctattccaccttctcatacgaaaca
ttcccggaggtgatgtccatgctgtggaagcgcatgctgcaggacaataaaaccaactgg
cgacgcacgtacaagagcctccttctgctaaactatttggtgcgaaacggctctgaacgg
gtggtaacctcctctcgggagcacatctacgatctgcgctcgctggagaactatacattc
accgacgagggcggcaaggatcagggtattaatgttaggcataaggtacgagagcttata
gactttattcaggatgatgatcgtttgcgcgaggagcgcaaaaaggcgaagaagaacaag
gacaagtacatcggcatgagcagcgacgccatgggcatgcgaagcggtggctacagcggc
tatagcggtggatctggaggaggcggcggtggcagcggtggctacaatgatggcgactat
cgctctagtcgtggagacaattggtactccgacaaaagcgccgacaaggatcggtatgag
gatgatgatactcactacgatggagagcgagagggatccgatagcgactcacccagtcca
agacgtaactatcgatacaatgaccgtgcgagtcctgccgaagtagccagcgaggccaaa
ccttccagcctcaacatgaacattcgttcgaagaccgtcagttcccctgtctccaagcag
cccacttcaacggcttctgccaagccagcgctgtcccagaagaagatcgatctgggtgcg
gcagcaaactttggaaagccagctcctggcggtgctgctggcattcactcaccaactcac
cgtgacactcccaccagcgtggacttgatgggcggcgcttcgccatcgccgtctacttcc
aaggcaaacaataatacgcaaagcaataacaacgatctgctggacgatctgttcaagacc
tgctcgccaccgccggggcaggagaagacgctgaacagtgctgccgtgattgtggatgac
gatgatgacttcaatccgcgtgccagcgatgctagccagcaggaattcggcgacttcgcc
tctgctttcgggcagccctcggcgggatcgacgatcagcgagccaccatcaacgggcctg
gttccggctgcgaacgatgagttcgccgactttgcggcgttccaaggctcgacaacgtcg
acatctgcgctggacggtaatttgctgaagactgccacgccggcgaacgattcgtttgac
ctgtttaattcagctcccacctcgacggcagcagccacaacggctacagatctcctggca
ggcctgggcgatctgtccattcaccaaagcatgcccatggacaatatgatgcctcccatt
cccgccgtcacgggcaataatctgctccagcccatgtcggtgaccaataataacaataat
accaacggaggcgcagtccccgccgctgccagtgtccagtctaccgctgtgggcgccacc
tggtcgggcgacctgaagggcggcaagatgaacattgacctggacaatctgctgatgagc
aagtcgggcaagcccagtgccccggccccttcgatgaatgccctgaagaccaacagtccg
gcaaaggcgccactgaatgtgcagacgggtggcggattccctggactgtcgccaatgacc
agtccgaacatttttggggctccggcaccgcagcaaagcattccacaaaaccaatcagca
tttgccaactttggagctttccagcagcagcagcagaatcacagcaataataacaataat
agctcgtcggcattcgacttgtttcaatga

DBGET integrated database retrieval system