KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4265Help
Entry
Dmel_CG4265       CDS       T00030                                 

Gene name
Uch
Definition
(RefSeq) ubiquitin carboxy-terminal hydrolase, isoform B
  KO
K05609  ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG4265 (Uch)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG4265 (Uch)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmel_CG4265 (Uch)
Peptidases and inhibitors [BR:dme01002]
 Cysteine peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   Dmel_CG4265 (Uch)
Ubiquitin system [BR:dme04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    Dmel_CG4265 (Uch)
  UBL-specific proteases (ULPs)
   Dmel_CG4265 (Uch)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C12
Motif
Other DBs
NCBI-GeneID: 33397
NCBI-ProteinID: NP_001188681
FlyBase: FBgn0010288
UniProt: P35122 M9MRD0
LinkDB All DBs
Position
2L
AA seq 227 aa AA seqDB search
MLTWTPLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETY
EKHRAEEHDRIKEVEEQHPEDLFYMRQFTHNACGTVALIHSVANNKEVDIDRGVLKDFLE
KTASLSPEERGRALEKDEKFTADHEALAQEGQTNAANHEKVIHHFIALVNKEGTLYELDG
RKSFPIKHGPTSEETFVKDAAKVCKEFMARDPNEVRFTVLALTAAQQ
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgttaacctggacgccacttgaatctaatcccgaggttttgaccaagtacatacataaa
ctgggcgtgtcgccagcctggtcggtaactgacgtcattggattggaagatgacaccttg
gaatggattccgcgtcccgtaaaggcgttcattttgctcttcccgtgcagcgaaacctat
gagaagcaccgcgccgaggagcacgatcggattaaggaggtggaggagcagcatcccgag
gatctcttctacatgcgccagttcacccacaacgcctgtggaaccgtcgccctgatccac
agcgtggccaacaacaaagaagtggacattgaccgcggagtactgaaggacttcctggag
aagacagcttccttgtccccggaggaacgcggacgggccctcgaaaaagacgagaagttc
accgccgatcatgaggccttggctcaagagggccagacgaatgccgccaatcatgagaag
gtgatccaccacttcatcgcactggtgaacaaggagggtactctgtacgagctggatggc
cgcaagtccttcccgatcaagcacggaccgacttcggaggagacttttgtgaaggatgcg
gccaaggtctgcaaggagttcatggctcgcgatcccaacgaagtgcgcttcaccgttttg
gccttgaccgcggcacaacaatag

DBGET integrated database retrieval system