KEGG   Drosophila melanogaster (fruit fly): Dmel_CG43122
Entry
Dmel_CG43122      CDS       T00030                                 

Gene name
cic
Definition
(RefSeq) capicua, isoform B
  KO
K20225  capicua transcriptional repressor
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG43122 (cic)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG43122 (cic)
Transcription factors [BR:dme03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    Dmel_CG43122 (cic)
SSDB
Motif
Pfam: HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 53560
NCBI-ProteinID: NP_001097843
FlyBase: FBgn0262582
UniProt: Q9U1H0
LinkDB
Position
3R
AA seq 1832 aa
MNAFQDFELGAKLYLQCLLSLSSSRSATPSYTSPVNHAGASPLNAIAHSPVNVSATHRQN
FFTPIANQSQQQQQQQPVAVPLDSKWKTTPSPVLYNANNNSSNNNTSSSNNNNNSNWEVG
SNSNTHVAATAAATSTVGAQPLPPQTTPVSLVMHAPPPQQQPLQQQHHHHQPPPPPPASL
PAPSAPPTSGSSSSHNSVGHATSVIRISSSQQQHQQQQQHQQQAHPHVVVSGGQTFHPVI
VDATQLSVPLPPTTVSFHQPNTPTSTAASVASMSQDKMLAKNGYNAPWFKLLPHMTPMSK
ASPAPVTPTLTTSASSYNVVMMQQQQQHQQLQQQQQLQQQQQSPPQMPLNHNNNHLIVSA
PLSSPGKPLNCSMNDAKVAAAAAAAAVANQRQKQQQEEPDDQLDDDVFETTTPGISANSK
KQTAAMRLPTHNSNIRKLEECHDDGAAGAPATSAAKRRSQSLSALQQQQQQQQQAGAAGT
AAGQPANKKIRRPMNAFMIFSKKHRKMVHKKHPNQDNRTVSKILGEWWYALKPEQKAQYH
ELASSVKDAHFKLHPEWKWCSKDRRKSSTSTATPGGKASGAAGTGDAKQRLVSVDGSDSL
EHDMCPSTPGGSGSCGGQGISSDLQGDIIPLTIDNYNSTCDEAPTTISMKGNGNGKLMKN
ELPSDEDEQMLVVEEEQQQQTVKKIDLHCRERVNDSDMDDTPFDYRKQQPEANQRSAEEH
STSGANGQAINAPPLSGGEREITLKPKAIKAHPVLESNMLPYTQMSIYTQYTSPKNPIGV
TPFQPTGGAFKSMPISPKGSGGKPEDAGSLQAHIKQEDIKQEPPSPYKLNNGSGSASGGG
VVSAPPPNSGSVGAIFNFNVPTATALSQKQFHYPMHHPHRSPTDLRDEEADREEITQGTK
SGESSEKDKPALDDQERDEVEEEDEDEEDDDEDDEDDEQFMQELASVNASAGFDDLVPYA
MPKVVITPTPTPPPVATIVTPIKRKQFTIVRSLTPLQPSNSPHQQLKHLHQRRGETPPTV
ITRVPTPTINHFTIIRTQQHPHTHPHNTPPPLFFKQKVQGSPVIATVTTSTLSSSSSNPA
NNEAPNKFSNFPTQHQPTTTTTISCNTNNNATPIIRKLLTLQEGAELGGSHKGTGRAAIL
YDALVLDTLHGQDEEEEEDEGNAEKQENPKVAGKEQVTTSQPATMLLITDVNAYNQQHVA
GNAATPVSGAATLRPVSFISINACNKITLPANARILTAATATSTAAGAAVTSQAGATLTV
MTKASAATNHSSSNASDITITAASAAPVPTSGSSIVMINSTTNPSTSSNSTSCSAAAHQA
CVPSSPAGMGLGHAANIATPPASAPAQIMGGGPASQKMFFAMTHPYTLLQRSHQPGTPSL
EHLQLDAFAPGGYTLRNHNGLSSLPPPVSAQPTMLLHGYPPSHGVEPPARSPSYKSMPST
PKSATYLMSAPPERGMDGGMSGCASAAASGGDESDIDADGQQFILAPTPAQLGRAPLQRR
KNLSQSKSESNVSFGANLGASNGQHISRKLHSPTMMESSSPIIGHVNSSNLSSALPTPTS
STTTPNSDEQLPLTPTTSSSNSNLNQQQPKSPMKGAPGSTAAALKKKNDEMNNSVLKQVD
FEKKYKALPQFQPEDCQSPSAIAVPSSPRVYGTNYRKKNTAPPPVQKLMCEDDSIDEPAS
APPTTTQRFFGPDFNNELKELESSDQTGRSPRTPKTPLQSARSDASEKGHRKVLETRRSL
VLQLFAEHGNFPTAQATMAFQSKHSDVFPRKQDLQLKIREVRQKLLGQASCTPHSAGPNT
PSDSNSSSTTLSASSTSLNMQTTSAADVFQYY
NT seq 5499 nt   +upstreamnt  +downstreamnt
atgaatgcgttccaggactttgagctgggggccaaactatatctgcagtgcttattatcg
ctgagcagctcccgatctgccacgccatcctacacctcacctgttaaccacgctggagct
tctcctctgaatgccattgcccattcgccggtgaatgtgtccgccactcataggcagaac
tttttcacacccattgccaaccagtcgcagcagcaacagcagcaacagcctgtggcggta
ccgctcgactccaagtggaaaacaacacccagtccggtgctctacaatgccaacaacaac
agcagcaataacaacaccagcagcagcaacaacaacaacaacagtaactgggaggtgggc
agcaatagcaatactcatgttgcagctacggcagcagcaacatcaacagttggcgctcaa
ccactgccgccgcaaacgacacccgtttcgctggtgatgcacgccccaccgccgcagcag
caaccactgcagcagcagcaccaccatcaccaaccgcctccaccgccacctgctagtttg
ccagcgccatcggcaccacccaccagcggcagcagcagcagccacaacagcgtgggccat
gccaccagcgttatacgcatttcgagcagccaacagcaacatcagcagcagcaacagcac
caacagcaggcacatccacatgtggtggtgagcggcggacagacttttcatcccgtaatc
gtggacgctactcagctatcggtgccgctgccacccacaacggtttcatttcatcagccc
aacacgcccacctcaacagcggcatcagtggcttcaatgagccaggacaagatgctggca
aaaaacggctacaatgcgccctggttcaagctgttgccgcatatgacgccaatgagcaag
gcgtcgccagctccggtcactccgaccctaaccacatcggccagcagttacaacgtggtg
atgatgcaacagcagcagcagcatcagcagcttcaacaacagcagcaactgcagcagcag
caacagtcgccaccccagatgccgctgaaccacaacaacaatcatctgattgtgtccgcc
ccactaagctccccgggcaagccactcaactgctcaatgaacgatgccaaggtggcggcg
gcagcagcagcggccgcagttgccaaccagaggcaaaagcagcagcaggaggagccggac
gatcagctggacgatgatgtgtttgagaccacaacgcccggtatcagcgccaacagcaaa
aaacaaactgcggcaatgcggctgcccacccacaacagtaacatacgaaagctggaggaa
tgccatgatgatggagctgcaggtgcaccagccacttcggctgccaagcggaggagtcaa
tcgttgagcgccctgcagcaacagcagcagcagcaacagcaggccggtgcggcaggaaca
gcagctgggcagccggcgaacaagaaaatccgaagacccatgaacgcttttatgatcttc
tcaaagaaacatcggaaaatggtgcacaagaagcatccgaatcaggacaaccgtacggtc
agcaagattctgggcgagtggtggtacgccctgaagccagagcaaaaggctcagtaccac
gagctggccagctctgttaaggatgcacacttcaagctgcatccggagtggaagtggtgc
tccaaagatcgccgcaagtcatccacctcgacagcaacgcctggtggaaaggcgagcgga
gcggccggaacaggtgacgctaagcagcgcctggtatcggtggatggctccgattccttg
gagcacgatatgtgcccctcaacgccaggaggcagcggcagctgcggtggccagggcata
tcatccgatttgcagggcgatattataccgctgacaattgacaactacaatagcacctgt
gatgaggcgccaactacgatctcgatgaagggcaatggcaacggaaagctgatgaagaac
gagctgccatcggacgaggacgaacagatgctggtagtggaggaggagcagcaacagcag
accgtaaagaagattgacctgcactgccgcgagcgggtgaatgactcggacatggacgac
acaccctttgactaccgcaagcagcagccagaggcaaatcagcgttcggcagaggagcac
agtacatccggtgcgaatggccaggccataaacgcaccgccgctcagcggaggagagcgc
gagatcacactcaaaccgaaggctatcaaagcacatccggtgctggagagcaacatgctg
ccatatacccagatgtccatctacacgcagtacactagtcccaagaacccaatcggtgta
acaccattccaacccacaggcggcgccttcaaatcgatgcccatcagccccaagggcagc
ggtggcaagccggaggacgctggctccctgcaggcacacatcaagcaggaggacatcaaa
caggaaccgccatcgccatacaagctgaacaatggttcgggatccgcctccggagggggc
gtggtcagtgctccgccgccgaatagtggtagcgttggtgccatattcaacttcaatgtg
ccaacggcgacggctttgagtcagaagcagtttcactacccgatgcatcatcctcatcgc
agtcccacagatcttagagatgaagaagcggatagggaagagattacacagggcacgaag
tcgggggagagtagcgaaaaggataagccggccttggatgatcaggagcgagatgaggtc
gaggaggaggacgaagacgaggaggatgacgacgaagatgacgaagatgatgagcagttc
atgcaggagctggccagtgtgaatgccagcgctggattcgacgaccttgttccatatgca
atgcctaaggtcgttataacgcccacccccacgccaccgcctgtggccaccatagtgacc
cccatcaagcgcaagcagttcaccatagtgcgatcgttgacgccgctgcagccttcgaat
tccccgcaccagcagttgaagcatctgcaccagcgtcgcggggaaactccgccgacggtc
atcacccgcgtgcccacgcccaccatcaatcacttcaccatcatacgaacgcaacaacac
ccacatacccatccacacaacactccgccaccgttgtttttcaagcagaaggttcagggt
tcaccagtgattgccacggtcacaacatccacattatcatcatcatcatccaacccagcc
aataatgaagcccctaataaattttccaattttccaacacaacaccaaccaacaaccaca
acaacaatatcatgcaatactaacaacaatgccacgccaatcatacgaaaattgttgacg
ctccaagaaggcgccgaactcggcggtagccataagggcacaggacgagcggcgatcctt
tacgacgctttggtgctagacacattgcacggtcaggatgaagaggaggaggaagatgag
ggcaacgcagaaaagcaggaaaatccaaaggtagcaggcaaggagcaggttaccacatcc
caaccggcgaccatgctactaatcaccgatgtcaacgcgtacaatcagcagcatgttgct
ggcaacgcggcaacacccgtgtcgggagcagctacccttcgaccagtgtccttcatcagt
attaatgcctgtaacaagatcacattgccagccaatgctcgtatcctaactgcggccacg
gcaacctccacggcagctggagcagcggttactagtcaggcaggagcaactcttaccgtg
atgacaaaggcgtcggcggcaacaaatcatagtagtagtaatgccagcgatataaccatc
acagcagcatcagctgctcctgtgcccaccagtggctccagtattgtcatgataaactca
accacaaacccgtctacatcatcaaattctacatcttgttccgcagctgcccaccaggcg
tgtgtgccatcgtcgccagcgggcatgggactggggcatgcggccaacattgccacgcct
ccagcatcggcgccggcccagatcatgggaggcggtccagccagtcagaagatgttcttc
gccatgactcatccgtatacgttgctgcagcgctcccaccaaccgggcacccccagccta
gagcacttgcagctggacgcttttgcgccaggaggttacaccttgaggaaccacaatggc
ctgtcttccctgccaccgcccgtgagtgcgcaacccacgatgctgctgcacggatacccg
cccagccatggtgtcgaaccaccggctagatcgccatcgtacaaatcaatgccatctact
ccaaagtcggccacatatctcatgagtgcgccaccggagcgaggcatggatggaggaatg
agtggatgtgcatcagcagcggcaagcggaggcgatgaaagcgacatagatgcggatggc
cagcagtttattttggcacccacgcctgcgcagttgggtcgagctccactgcagaggagg
aagaatctatctcaaagcaagtcagagagcaatgtgtcctttggcgctaatctgggggcc
agcaatggacagcacattagtcgcaagctgcactcacccacaatgatggaatcctcatcg
cccatcataggccacgtgaacagcagcaacctcagctcggccctgccaacgcccacgtcc
tcgacgacgacaccaaacagtgatgagcaactgccactgacgccgacaaccagcagcagc
aacagtaacttaaatcagcagcagcccaagtcaccgatgaaaggtgctccaggatcaacg
gcagcggccctaaaaaagaagaacgatgagatgaataacagtgtgctcaagcaggtagat
ttcgaaaagaaatacaaggccctgccgcagttccagcctgaggattgccagtcgcccagt
gccattgctgtgccctcatcgccacgcgtttacggcacgaattaccgcaagaagaacacg
gctccaccgccagttcagaagctaatgtgcgaggacgactccattgacgaaccagcatcg
gcaccgcctacgaccacacagcgattctttggtccggactttaacaatgagctaaaggaa
ctggagagctctgaccaaacgggccgctcacccaggacgccaaagacaccgctacaaagc
gctcggtccgatgccagtgagaaaggacaccgcaaggtcctggagacgcgtcgcagcctg
gtcttgcagttgtttgccgagcacggtaacttccccactgcccaggccactatggccttt
cagtctaagcacagcgatgtctttccgcgcaagcaagatctgcagctgaagatacgagag
gtgcgccagaagctgctgggccaagcatcttgcactccacactcggcgggccccaacacg
ccgtccgactccaactcgtcgtcgaccacattgagtgccagtagcaccagcttgaatatg
cagaccaccagtgcggcagatgtttttcaatattactga

DBGET integrated database retrieval system