KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4319
Entry
Dmel_CG4319       CDS       T00030                                 

Gene name
rpr
Definition
(RefSeq) reaper
  KO
K20014  cell death protein rpr
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04214  Apoptosis - fly
dme04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG4319 (rpr)
   04215 Apoptosis - multiple species
    Dmel_CG4319 (rpr)
SSDB
Motif
Pfam: Bunya_NS-S
Other DBs
NCBI-GeneID: 40015
NCBI-ProteinID: NP_524138
FlyBase: FBgn0011706
UniProt: Q24475
LinkDB
Position
3L
AA seq 65 aa
MAVAFYIPDQATLLREAEQKEQQILRLRESQWRFLATVVLETLRQYTSCHPKTGRKSGKY
RKPSQ
NT seq 198 nt   +upstreamnt  +downstreamnt
atggcagtggcattctacatacccgatcaggcgactctgttgcgggaggcggagcagaag
gagcagcagatccttcgcttgcgggagtcacagtggagattcctggccaccgtcgtcctg
gaaaccctgcgccagtacacttcatgtcatccgaagaccggaagaaagtccggcaaatat
cgcaagccatcgcaatga

DBGET integrated database retrieval system