KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4345
Entry
Dmel_CG4345       CDS       T00030                                 

Gene name
grim
Definition
(RefSeq) grim
  KO
K20018  cell death protein Grim
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04214  Apoptosis - fly
dme04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG4345 (grim)
   04215 Apoptosis - multiple species
    Dmel_CG4345 (grim)
SSDB
Motif
Pfam: TFIIA DUF2367 Presenilin
Other DBs
NCBI-GeneID: 40014
NCBI-ProteinID: NP_524137
FlyBase: FBgn0015946
UniProt: Q24570 A0A1B2AIX9
LinkDB
Position
3L
AA seq 138 aa
MAIAYFIPDQAQLLARSYQQNGQQTAASPRTTATAAAPSQQQQQSQQQQQQQRHHHQQQR
PQFRANISVPLGSQQGSMTMSEFGCWDLLAQIFCYALRIYSYSSSQRQPTVIQISFEISS
GGQNNDEDDVTDATSKEN
NT seq 417 nt   +upstreamnt  +downstreamnt
atggccatcgcctatttcatacccgaccaggcccaattgttggccagaagctatcagcaa
aacggccagcagacagcagcgagtccaaggacaactgcaacagctgctgcaccatcgcag
cagcagcaacaatcgcaacaacagcagcagcagcagcgacatcatcatcagcaacagcgc
ccacaattccgtgccaatatttccgtgccgctgggaagtcaacagggatcgatgaccatg
tcggagtttggatgctgggatcttttggcccagatcttctgctacgctctgcgaatctac
agctacagttcgagccagcgtcaaccgacggtcattcagatatccttcgagatcagcagc
ggcggtcagaacaacgatgaggacgacgtgactgatgccacctccaaggagaactaa

DBGET integrated database retrieval system