KEGG   Drosophila melanogaster (fruit fly): Dmel_CG43664Help
Entry
Dmel_CG43664      CDS       T00030                                 

Gene name
Su(var)3-9
Definition
(RefSeq) suppressor of variegation 3-9
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Dmel_CG43664 (Su(var)3-9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG43664 (Su(var)3-9)
Enzymes [BR:dme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Dmel_CG43664 (Su(var)3-9)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Dmel_CG43664 (Su(var)3-9)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    Dmel_CG43664 (Su(var)3-9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo GTP_EFTU Dynamin_N
Motif
Other DBs
NCBI-GeneID: 41483
NCBI-ProteinID: NP_524357
FlyBase: FBgn0263755
UniProt: P45975 I0DHL3
LinkDB All DBs
Position
3R
AA seq 635 aa AA seqDB search
MATAEAQIGVNRNLQKQDLSNLDVSKLTPLSPEVISRQATINIGTIGHVAHGKSTVVKAI
SGVQTVRFKNELERNITIKLERLSEKKIKNLLTSKQQRQQYEIKQRSMLRHLAELRRHSR
FRRLCTKPASSSMPASTSSVDRRTTRRSTSQTSLSPSNSSGYGSVFGCEEHDVDKIPSLN
GFAKLKRRRSSCVGAPTPNSKRSKNNMGVIAKRPPKGEYVVERIECVEMDQYQPVFFVKW
LGYHDSENTWESLANVADCAEMEKFVERHQQLYEIYIAKITTELEKQLEALPLMENITVA
EVDAYEPLNLQIDLILLAQYRAAGSRSQREPQKIGERALKSMQIKRAQFVRRKQLADLAL
FEKRMNHVEKPSPPIRVENNIDLDTIDSNFMYIHDNIIGKDVPKPEAGIVGCKCTEDTEE
CTASTKCCARFAGELFAYERSTRRLRLRPGSAIYECNSRCSCDSSCSNRLVQHGRQVPLV
LFKTANGSGWGVRAATALRKGEFVCEYIGEIITSDEANERGKAYDDNGRTYLFDLDYNTA
QDSEYTIDAANYGNISHFINHSCDPNLAVFPCWIEHLNVALPHLVFFTLRPIKAGEELSF
DYIRADNEDVPYENLSTAVRVECRCGADNCRKVLF
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggccacggctgaagcccagatcggtgtgaacaggaacttgcagaagcaggacctcagc
aacttggacgtctctaaactaacgcctctatcaccggaggtcatctcccgacaggcgacc
atcaacatcggcaccatcggtcatgtggctcacggcaaatccacggtggtcaaagccata
tccggcgtgcagactgtgcgcttcaagaacgaactggagcgcaacatcacaatcaagctg
gaacgcttgagcgaaaaaaaaatcaaaaatcttttgacctccaagcagcagcgacagcag
tatgaaatcaaacagcgttcaatgctgcgccacctggccgaattgcggcgacatagccga
ttccgccgcctctgcaccaagccagcttcgtcttccatgccagcatccacctccagtgta
gatagacgcaccacccggcgaagcaccagtcagacctcactgagtccaagcaatagtagc
ggctatggcagcgtttttggctgcgaggaacatgatgtggacaaaatacccagtctcaac
ggattcgccaaactgaagcgtcgacgcagcagttgtgtgggcgccccaactcccaactcc
aagcggtcgaaaaataacatgggagtaattgccaaaaggccgcccaaaggagagtacgtt
gtggagcgtattgaatgcgtcgagatggatcaatatcagccagtcttcttcgtcaaatgg
ctgggataccatgatagcgagaacacctgggaaagtcttgccaacgtggccgactgcgcc
gaaatggagaagtttgtggagcggcatcagcagctctacgagatatacatagccaagata
accactgagcttgagaagcagctggaggcattgccactaatggagaacattacggtggcc
gaagtagacgcctatgagccactcaatctgcagatcgatcttatactgctcgcccaatat
cgcgctgctggcagtcgaagccaaagggaaccgcagaaaattggagaacgagccctgaaa
agcatgcaaatcaagcgggcccaatttgtacgacgcaagcagttggctgatctagcattg
ttcgagaagcgcatgaatcatgtggagaaaccgtcaccgccaatacgtgttgagaacaac
attgatctggacaccatagacagcaatttcatgtacatacatgataacataatcggcaag
gatgtgcccaagccggaagcggggattgtgggctgtaagtgcactgaagacacagaggag
tgtactgcctctacgaagtgttgtgcccgcttcgccggcgagctgttcgcctacgagcga
agcacacggcgcttgcgccttcgtcccggaagtgccatctatgagtgcaatagccgctgc
tcgtgcgattcaagctgctccaaccgtctggtgcagcacggacgccaggtaccgttggtg
ctgtttaagaccgccaacggcagcggatggggggtgcgagccgcaactgccttgcgtaag
ggtgaatttgtgtgcgagtacattggagagatcatcaccagcgatgaggcaaatgagcgc
ggcaaggcgtatgacgacaatgggaggacatatctgttcgacttggattacaacacagct
caggatagcgagtacactatcgatgcagctaactatggcaacatctcgcactttatcaat
cactcttgcgatcctaatctcgccgtgttcccctgttggatcgagcacctgaatgtcgcg
ctgccgcacctcgtgttcttcacactgcgtccaatcaaggcgggcgaggagttgagcttc
gactacattcgcgcggacaacgaagatgtgccctacgagaacctctcgacagctgtgcgt
gtcgagtgccgctgcggagctgataattgcagaaaggtcctcttttga

DBGET integrated database retrieval system