KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4406Help
Entry
Dmel_CG4406       CDS       T00030                                 

Gene name
PIG-K
Definition
(RefSeq) phosphatidylinositol glycan anchor biosynthesis class K
  KO
K05290  GPI-anchor transamidase subunit K
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    Dmel_CG4406 (PIG-K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C13
Motif
Other DBs
NCBI-GeneID: 31163
NCBI-ProteinID: NP_569968
FlyBase: FBgn0023545
UniProt: Q8T4E1
LinkDB All DBs
Position
X
AA seq 355 aa AA seqDB search
MFNIMLVKFVVIFALILASCRVEADNTSVLPEGFVDAAQRSTHTNNWAVLVDASRFWFNY
RHVANVLSIYRSVKRLGIPDSQIILMIADDMACNARNPRPGQVYNNANQHINVYGDDVEV
DYRGYEVTVENFVRLLTGRTQNGTARSKKLLSDAGSNVLIYLTGHGGDGFLKFQDSEEIT
SQELADGIQQMWEKKRYNELFFMVDTCQAASLYEKFTSPNVLAVASSLVGEDSLSHHVDP
SIGVYMIDRYTYYALEFLEKVQPFSKRTIGEFLQVCPKRVCISTVGVRKDLYPRDPHKVP
ITDFFGAIRPTRVSTDRINVTLANEDDFIFDKDKMVTKKPFKIVMESQFPSELFK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatattatgcttgttaaatttgttgtcatctttgccctgatcctcgccagctgt
cgggtggaggcggataacacctcggtgttgccggagggctttgtggacgccgctcagcgc
tctacacacacgaacaactgggcggtgctggtggacgcatcgagattctggttcaactac
cggcatgtggccaatgtgctgtctatctaccgctcggtaaagagactgggcattcctgac
tcccagatcatactgatgatcgccgacgacatggcctgcaatgctaggaacccacggccc
ggccaggtgtacaataacgccaaccagcacatcaatgtgtacggagacgatgtagaggtg
gattaccgcggctacgaggtgacagttgagaactttgtgcgtctgctaactgggcgcacc
cagaacggcacggcgcgctcgaagaagctgctctcggacgcgggcagcaatgtgctcatc
tacctaaccggacacggcggcgatggattcctcaagttccaggactcggaggagataacc
agccaggagttggccgacggcatccaacagatgtgggagaaaaagcggtacaatgagcta
ttcttcatggtggacacttgccaagcagcttcgctctatgagaagttcacctcgccgaat
gtcctggcagtggctagcagtcttgttggcgaggattccttatcgcaccatgtggatcca
tcgattggagtctacatgatagaccggtacacctactacgccttggagttcctggagaag
gtgcagccctttagcaaacggaccataggcgaatttctgcaagtgtgccccaagagagtg
tgcatttcgacagtgggagtgcgcaaggatctgtacccccgggatccgcacaaggtgccc
atcacagacttctttggagccatacgtcccacacgggtatccaccgatcgcatcaatgtg
accttggccaatgaggatgatttcattttcgacaaagataagatggtgaccaaaaagccc
ttcaaaatcgtgatggagtcacagtttccttccgagctttttaaatag

DBGET integrated database retrieval system