KEGG   Drosophila melanogaster (fruit fly): Dmel_CG44246
Entry
Dmel_CG44246      CDS       T00030                                 

Gene name
Atf-2
Definition
(RefSeq) activating transcription factor-2
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG44246 (Atf-2)
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    Dmel_CG44246 (Atf-2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dme03000]
    Dmel_CG44246 (Atf-2)
Transcription factors [BR:dme03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    Dmel_CG44246 (Atf-2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4094 IFP_35_N DUF1465 Cnn_1N Jnk-SapK_ap_N YabA ZapB FapA CENP-F_N KASH_CCD DivIC DUF3287 CENP-H TMF_DNA_bd Cep57_CLD_2
Other DBs
NCBI-GeneID: 37978
NCBI-ProteinID: NP_001033973
FlyBase: FBgn0265193
UniProt: Q2PE13
LinkDB
Position
2R
AA seq 381 aa
MDTAGDMDHLASVSFGDFETKSPEGDVSCYQNFRAQTEHVSLDISLGQKSDTLFAADQTP
TPTRLIKNCDEVGLFEDLQHVNPFDIGFQQAAERNVSGTPSRPEARPNDGESLHTPQVYP
VEAPTVVSVPSENQVPQSVSCGDMDVDQLLATTVTSPSKASQDGPPPLQLIQPQVLTWVL
PAQSVPISIATVDCNRNRVKPTGAIHPFILPKPTAKELNKTSKRPEPILVSCNPPNNEPS
SASLTPTSQLPIKERLKAIIHSNNNRRSFSTPPKAAKAKDRSRDEDCMERRRAAASRYRN
KMRNEHKDLIKQNAQLQQENQELHERISRLEKELQQHRSHSSLAGVVADQLRIPPSSIHL
LINVPNVLVPSSASNASAAKK
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggacaccgccggagacatggatcacctggccagtgtgtccttcggcgactttgagaca
aaatccccagagggcgacgtatcctgctatcagaactttcgggcacagacggaacatgtt
tcgctagacatttctctcgggcagaagtcagacactctatttgccgccgaccaaacgccc
acgcctacgcgactcatcaagaactgcgacgaggtgggtctcttcgaggacctgcagcac
gtaaatccatttgacattggattccagcaagcagcggagcgaaatgtcagcggcactccg
agtcgcccagaggctcgacccaatgacggtgagtccctgcacacgccccaggtgtatccc
gtcgaggcccccaccgtggtatcagttccgtctgaaaatcaggtcccacaaagtgtcagc
tgcggcgatatggatgtggaccagcttctggccacgacagttacctcgccttccaaagcc
agtcaagatggtccgccgccgctgcagttgatccagccccaggtcctaacatgggtgctg
cctgcgcagtcagttcccatttccatcgctacagttgattgtaacagaaacagggtgaag
ccgactggtgccattcatcccttcatactgccgaaacccactgcgaaagaattaaacaag
accagtaaaagacccgagcctattttggtcagttgcaacccacctaataacgagcccagt
agcgccagtctgacgcccacctcacagctgcccatcaaggagcgattgaaggccattatc
cacagcaataataacagacgaagtttctccacaccgcccaaggctgcgaaagcaaaggat
cgcagtcgggacgaggattgtatggagcgacgaagagcagcagcctctcgttaccgtaac
aagatgcgaaacgagcataaggacctcatcaaacagaacgcccagctgcagcaggagaat
caagaactgcacgaaagaatttccagattagaaaaggaactgcagcagcacaggagtcac
agcagcttagctggcgtggtggccgaccagctgcggattccaccatccagtatacacttg
ctcatcaatgtgcccaacgtgttagtgccttcgtccgccagcaacgcaagcgcggccaag
aaataa

DBGET integrated database retrieval system