KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4649Help
Entry
Dmel_CG4649       CDS       T00030                                 

Gene name
Sodh-2
Definition
(RefSeq) sorbitol dehydrogenase-2
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00040  Pentose and glucuronate interconversions
dme00051  Fructose and mannose metabolism
dme01100  Metabolic pathways
Module
dme_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dmel_CG4649 (Sodh-2)
   00051 Fructose and mannose metabolism
    Dmel_CG4649 (Sodh-2)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Dmel_CG4649 (Sodh-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Pyr_redox_2 AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 41313
NCBI-ProteinID: NP_524311
FlyBase: FBgn0022359
UniProt: O96299
LinkDB All DBs
Position
3R
AA seq 360 aa AA seqDB search
MATDNLTAVLHGIEDLRLEQRPIPEIADDEVLLAMDSVGICGSDVHYLAHGRIGDFVLTK
PMIIGHEAAGVVAKLGKKVTTLKVGDRVAIEPGVPCRYCDHCKQGRYNLCADMVFCATPP
YDGNLTRYYKHAADFCFKLPDHVSMEEGALLEPLSVGVHACRRAGVGLGSKVLILGAGPI
GLVTLLAAQAMGASEILITDLVQQRLDVAKELGATHTLLLQRDQSAEETVKVVHQTMSEV
PDKSIDCCGAESSARLAIFATRSGGVVVVVGMGAPEVKLPLINALAREIDIRGVFRYCND
YSAALALVASGKVNVKRLVTHHYDITETAEAFETSRRGTGGAIKVMIHVQPRDANNKVKF
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagacaatttaacagctgttctccacggcatcgaggacctgcgattggagcaa
cgcccaattccggaaatcgccgacgatgaggttctcctggccatggacagcgtgggcatc
tgcggatccgacgtgcactaccttgcccacggacgcatcggggactttgtgctgaccaag
ccgatgatcattggccacgaggcagccggcgtggtggccaagctgggcaagaaagtgacc
accctcaaggtgggcgaccgcgtggccattgagccgggagtgccctgccgctactgcgat
cactgcaagcagggtcgatacaacctgtgcgccgacatggtcttttgtgccacacctccg
tacgatggaaacctgaccaggtactacaaacacgccgccgacttttgcttcaagctgccg
gatcacgtcagcatggaggaaggagctctgctggagcccctgtccgtgggagttcacgcc
tgccgtcgcgcaggagtcggtctgggctcaaaggtgctcattctgggcgctggtccaatt
ggtttggtcaccctgctggctgcccaagctatgggtgcatccgagatccttatcaccgat
ctggtgcagcagcgtttggatgttgccaaggagctgggcgccacacacacgctgcttctg
cagcgggatcagtccgccgaggagaccgtcaaggtggttcaccagacgatgagcgaggtg
ccggacaagtccatcgactgctgtggagccgagagcagtgcccgcctggccatcttcgcc
actcgctccggcggagtagtagtggttgtgggcatgggtgcacccgaggtcaagctgccc
ctgatcaacgctttggcacgtgagatcgacattcgtggtgtcttccgctactgcaatgat
tattccgccgctttggctctggtggcttcgggcaaggtgaatgtgaagcgtctagtgacg
caccactacgacatcacggagacggctgaggcgtttgagacctcccgccgcggcaccggt
ggcgctatcaaggtcatgatccacgtccagccgagggacgcgaacaacaaagtcaagttc
tga

DBGET integrated database retrieval system