KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4790
Entry
Dmel_CG4790       CDS       T00030                                 

Gene name
fs(1)M3
Definition
(RefSeq) female sterile (1) M3
  KO
K20227  female sterile (1) M3, polehole
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG4790 (fs(1)M3)
SSDB
Motif
Pfam: BppL_N EPTP
Other DBs
NCBI-GeneID: 45994
NCBI-ProteinID: NP_572284
FlyBase: FBgn0005390
UniProt: Q9W451
LinkDB
Position
X
AA seq 1836 aa
MISPSVCAALFSVLVLNSYIAQVQSELSAAEVAGDPSAAQLLPSSCRNGLNGSSSGPEIR
LPFVDMMVRHEKPLFVLREPEEDLLLLLHGHEIFQLHVATGERRLVPLGYLAGQVSGRRA
LGAEVVAWREFLLLAIVLDDSMEVYQLPKELLLSEDPATQVSFEPLQEFSLPGAFLQLHL
LKPSGDQVLLLVASNHTRSHSKCRTFEWLDTYFNPLEEITLPAIRVLQVVGRQPLYIIFG
RSLKGSQSKLVLTIYELDRNSRILQQRQALTVQAQSVQAVRFHGRNCLIACTSSASASCI
FFRMVDGQFVVYRKHARKDLSFRRLSATKKGHLLIGARANGEVIVFSSTRLDCYSGFQVA
GEADPSGLLIHKNLHNETFLLLAYRRSSSDLIRTVQLGGVEEISNQVGAAPDEDLSVVQL
HRHEFEESINALRGLLLRRRSSTENLRNIVDILKRKSAIHLDTPLHLVQQGQIGRLQLVD
EHLRTPTQLKQRLEELRQRFKAIQTRRTTRSFGTGNENDEPETLKARRLRVGNLIYKGQL
ISGHILDNSKPPMLTIRNSPLQTKKLRVNQLVTPQDFRNSSGAQIAPEETSGSECVVRHL
RVEQINGVQWNDFLDSLFLRSRDTSIEGRLVMQSRVRVNSLKTPLLNGLVVDRLFNLRRA
QVISSNIYMSAFFAPRLEAQQVNGLDFAHDVLHRGSNDTWIKTPVRINQMSVSGDIFVGN
TSKWQPQPRQLDDPMEQRLQQYYTGRVTIRGSLTVTNVLRDTANSLIVLGNQSLARKDIQ
STYLLDQTPQNLTNLTFGHARVSVPSMTTSYVDGHPVRDHLLSGGQQNQHTHPNNTLHII
FMNATILGDVICRDYSSRLAEIAKDAVSHGDAVNITGHKHFQAPLTVQALQANEINGVPV
SEIVVKSNTTQNFTGTKTFARVVVANDINVHDHLNVSHLNGLPLQQLLGHDISLQRLELT
ETPHLENLHFRRLNGLPFDELLSKISEDGEQPLLLHKQLLIEGNVRFDKAVQVQNINGIQ
WDEYLDRLVRSDSNAEIRGKKTFMADVQINDALQSPHINNLDLSSLLDNTLLRMTPQQIS
GAYTFDRMMATNVDVNRINGVPKEEFIDTRKDLELKGDLYLKQLNINGSLKCPFVNEAVL
NDLKQRVEQVQQLPWRNLIVTGDALWDGEEQSQSQLDYLRQHAVRRVGNQTIAGHVLLKE
PYLKDIQSKHSLPIDLNFTQLAEDALLRRSPTNETQVITAPQELQGLVRANTLHLEQDAH
FELVNGIDIRRFNASLYRLSSGEAIAADLHFHQAPKIGKLQLEYPEVNGAPIQSIYQQGK
GQSWPPVTFKNLFVEQDLNLKTVNNMNLDYFLQHRIPLKGDALEVFGSLTFEHLQLSGKP
LLRSINGIQLDNLVFRHSNRTQSITGAKTFRGGVEFTGPGHVMNLNGRELSESFRGSIFR
NKDYNIDSLVLDKALFPGGLVLAGLQSQIPNRMRATEVQSNPLEEFQELLALGNQTSPRR
LLYLDHDTESLESTWVKGPFRGSSELQVSLPLGYSAPCQRRTLQAKLLIHERRVLLANSS
VSNQLMRLHSGDIRVKVQNHCHRPARRLRSRIRISCRNETHTLGMRQSVEAMELLEMGEM
VLLLLGTEEEVRVLRLKRSNCSLTDWQSVLPADGRLMKLVRMGVESRQDLILTSGMSNHR
PVLAIHYRDPLNHNFKMLQLIQGSYDLAEMQGNQLLVSCLGCRHIAIFKRYSHSAEILFE
PIQQLSFQERIQQLTPFKVGNEQYLLVVTQPEEEHFYLFSYNEVGGWQQRTFGIKKQDQW
AWSLVKSGQMLEAAETPILLLCGKKRECSLVKALLG
NT seq 5511 nt   +upstreamnt  +downstreamnt
atgatttcgccaagcgtgtgtgcagcattatttagtgtgttagtgttaaatagctatatc
gcccaagtacaaagtgaattatcagcagcagaagtcgctggagatccgagtgctgcccag
ctgctgcccagttcctgtcgcaatgggttgaatggcagtagctctggcccggaaatccgt
ctgccctttgtggacatgatggtgcgccatgagaagccactctttgtgctccgcgaaccg
gaagaggatctacttttactgctccatggacacgagatttttcagctgcacgtggccact
ggggagaggcgtctagtgccgcttggttacttggcgggccaggtcagtggtcgcagagct
ctcggagcagaggttgtggcctggcgggagttcctgctccttgccatcgttctggatgat
tccatggaggtttaccagttgcccaaggaactgctcctatccgaagatccagccacacag
gtgagctttgagcccctccaggagttctcgctgccaggtgcttttctacagctgcacctt
ttgaaacccagtggagatcaggtgctcctcctagtggcctccaatcacaccagatcacac
agcaaatgcagaacctttgagtggctggacacctactttaatccactcgaggagatcact
ctacccgccattcgcgttctccaagtggttggtcgtcagccactttatatcatttttggt
cgttctttaaagggttcccagtcaaagctggtgctcacaatctacgagctggatagaaac
agccgaatcctgcaacaacgccaggctttgacagttcaggcgcaaagtgtccaagctgtt
agatttcacgggaggaactgcctcatcgcctgtacttcctctgcatctgcctcgtgtatt
ttcttccgaatggtggatggacaatttgtggtgtaccgaaagcatgctcgaaaagatttg
agtttccgtcgattgagtgccaccaaaaagggtcaccttttgattggtgcccgtgccaat
ggcgaggtgatcgtcttcagctccactcgcctggattgctatagtggatttcaggtggct
ggagaagcggatccaagtggattacttattcataaaaacttgcacaatgagacctttctt
ttgctggcctatcgaagatcctcgagtgatctgatccgaactgtgcaattgggtggcgtg
gaagaaatctccaaccaagtgggcgctgctccagatgaagatctaagtgttgtccaattg
catcgtcacgagtttgaggagtccatcaatgccttacgtggcctcctgctgcgccgtcgt
tcctctacagaaaacctgagaaacattgtggacatcttaaaacgcaaatcggccatccac
ctcgacacgccactgcatctagtgcagcaaggacaaataggaagacttcagttggtggac
gaacatctgcgcacgcccacccaattaaagcaacgcttggaggaacttcgtcaacgattt
aaagcgatccagaccaggcgaaccacacgctcttttgggacaggaaacgagaacgatgag
ccggagacactcaaagcgcgacgattgcgcgtgggcaatcttatctacaagggacagcta
atttcaggccacattttggataactcaaaaccacctatgttgaccatcagaaacagtcct
ttgcagacgaaaaagcttagggtaaatcaattggttactccccaagatttccgcaactcc
agtggtgcccagattgcgcctgaggaaaccagtggcagtgaatgtgtagttcgtcatctc
cgagtggaacagataaacggagtgcagtggaacgactttttggactcgctcttcctgcgc
agtcgtgacacttcgatagaaggacgcttggttatgcaatcgcgagtccgggtgaacagt
ctaaagacacctctgctcaacggactcgtggtggatcgtctctttaatctgcggcgtgcc
caggtgatcagttcgaatatctacatgtccgccttctttgctccgcgtttggaggctcag
caagtaaatggacttgactttgcccacgatgtacttcatcgcggtagcaatgatacatgg
ataaaaactcctgttcgcatcaatcagatgagtgtttcgggtgacatttttgtgggcaat
acgagcaagtggcagccacagcccagacaactcgacgatccaatggaacaacgtcttcaa
cagtactacacgggcagggtaaccatccgcggatccctgacggtcacaaatgtcctgcga
gacacggcaaactcacttatagtgctcggaaaccaatctctcgccagaaaagatatacaa
tctacgtaccttcttgatcagacgccacagaacctcactaacttgacctttggacatgcc
agagttagtgttccctcaatgaccaccagttatgttgacggtcatcctgtgagggatcat
ctcctaagcggaggacagcagaaccaacatactcacccaaataacactctacacattatc
tttatgaatgcaaccatactgggcgatgttatttgcagggattacagttcccgtttggcg
gagatcgcaaaagatgcagtgagtcatggagacgctgttaatatcacggggcacaaacac
ttccaggcacctttgactgttcaagcacttcaagccaatgaaataaacggagtacctgtt
agtgaaatagtggtgaaatcaaacaccacccaaaactttacgggtacaaagacctttgcc
cgtgtggtggtggcgaatgatatcaacgttcatgatcatttgaatgtgagtcatcttaat
ggattgccattgcaacagctgcttggtcacgatatcagcctgcaacgcctcgaactaacc
gaaaccccacatctggagaatcttcattttcggcgacttaatggattgcccttcgatgaa
ctgctgtccaaaatttcggaagatggtgaacagcccctacttcttcacaagcaactattg
atcgaaggaaatgtacgatttgacaaggctgtccaagtgcagaacattaatggaatccaa
tgggacgagtacctagatcgcctggtgagatctgattctaacgcggaaatacggggtaaa
aagacattcatggccgatgtccaaataaatgatgccctgcaaagtcctcacatcaataat
ttggatctaagttccctgctcgacaacaccttactgcgaatgacaccccagcaaatcagt
ggtgcttacactttcgaccgcatgatggccaccaatgtggatgtaaatcgaataaatggg
gtacccaaggaggaatttatagacacacgcaaagacttagaactaaaaggagatctttac
ctaaagcaactgaacatcaatggcagcctaaagtgtccctttgtcaatgaggcagtttta
aatgatctcaagcaacgagtggagcaagtgcagcaacttccctggcggaatttgatagtc
accggcgatgctctatgggatggtgaagagcagtcccaatcccagctagactacctacgc
cagcatgcagtcaggagagtgggcaaccagaccattgccggacacgttctactgaaggaa
ccctacttaaaggatatccaaagtaagcattccctgccaattgatcttaacttcactcaa
ttggccgaagatgccctacttcgccggagccccacaaacgaaacccaggtgataacagct
ccgcaagagctacagggattagttagagctaatactctacacttggagcaggatgcacac
tttgagctggtaaacggaatcgatatacgacgattcaatgcctcactgtaccgcctctcc
agtggagaagccattgcagcggatcttcactttcatcaggctccaaaaataggcaaactt
caactggagtatccagaagtgaatggagctccgatacaaagtatataccagcagggcaag
gggcaatcctggccacccgtaacgttcaagaacctctttgtcgaacaggacctgaatctg
aaaaccgtaaacaacatgaatctggactactttctacaacatcgcattcccttaaaggga
gacgcattggaggtattcggttcactgacttttgagcaccttcagctgagtggaaagcct
cttctacgttctatcaatggcattcaattggataacttggtgtttcggcatagcaatcgg
acgcagagcatcacgggtgccaagacttttcgtggaggagtggagttcactggacccggt
catgtgatgaatctgaatggacgtgagcttagcgaaagtttcaggggcagcatctttcga
aataaggactacaacatcgatagtctagttctggacaaagctctcttcccaggtggacta
gttttagcaggacttcaaagtcaaattcccaatcgaatgcgagcgacggaagtgcaaagc
aatccgttagaggagtttcaagaacttctagcattgggtaatcaaacttcgcctaggagg
ctactttacctggatcacgacaccgaaagtctggagtctacttgggtaaaaggccctttt
aggggatcttcggaactgcaggtgagcctgcccttgggttattctgctccatgtcagcgt
aggactttacaagccaagctcctgatccacgaacgtcgcgtcctcctggccaactcgagt
gtgtccaatcaactgatgagacttcactccggagatatccgggtgaaggtgcagaaccac
tgtcatcgcccagcacgaagattgcgcagcaggatcagaattagttgccgtaatgaaacg
catacgctgggaatgcgtcaatcagtggaagccatggaactgctggaaatgggggaaatg
gtgctgctgctcttgggcaccgaggaggaagttcgtgtcctgcgtctgaagaggagcaac
tgtagtctcaccgattggcaatccgtgctaccagcagatgggcgccttatgaagttggtt
cgaatgggggtagagtcccgacaggatctaatactcaccagtggcatgagtaatcatcgt
cctgtcctggccatccattatagggatcccttaaatcataacttcaaaatgcttcagctg
atccagggctcatatgacctggcagagatgcagggaaaccaacttctggtcagctgtttg
ggttgtcgacacatagctatctttaaacggtactctcattccgcggaaattctgtttgag
cccatccagcagttgagcttccaggagcgcattcaacaactaactccattcaaagttgga
aatgagcaatatctattggtagtaacgcagccggaggaagaacacttttacctcttcagc
tataatgaagtaggcggttggcaacagcgtacgtttggcattaagaaacaggaccagtgg
gcgtggtcactggtgaaatctggtcaaatgcttgaagccgccgagacccctattctgctg
ctctgcggaaagaaacgggaatgtagtctagtgaaagccctactgggctaa

DBGET integrated database retrieval system