KEGG   Drosophila melanogaster (fruit fly): Dmel_CG4869Help
Entry
Dmel_CG4869       CDS       T00030                                 

Gene name
betaTub97EF
Definition
(RefSeq) beta-Tubulin at 97EF, isoform B
  KO
K07375  tubulin beta
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04145  Phagosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    Dmel_CG4869 (betaTub97EF)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     Dmel_CG4869 (betaTub97EF)
Cytoskeleton proteins [BR:dme04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    Dmel_CG4869 (betaTub97EF)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG4869 (betaTub97EF)
  Exosomal proteins of colorectal cancer cells
   Dmel_CG4869 (betaTub97EF)
  Exosomal proteins of bladder cancer cells
   Dmel_CG4869 (betaTub97EF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2 VERL
Motif
Other DBs
NCBI-GeneID: 43359
NCBI-ProteinID: NP_001163753
FlyBase: FBgn0003890
UniProt: Q8MST5
LinkDB All DBs
Position
3R
AA seq 457 aa AA seqDB search
MREIVHLQAGQCGNQIGSKFWEIISDEHGIDPNGYYHGESALQHERIDVYYNEASSGKYV
PRAVLIDLEPGTMDSVRQSPVGQLFRPDNFVYGQSGAGNNWAKGHYTEGAELIDSVLEVL
RKESEGCDCLQGFQLAHSLGGGTGSGLGTLLISKIREEYPDRIMNSFSVVPSPKVSDTVV
EPYNATLSIHQLVENTDETFCIDNEALYDICFRTLKLSSPTYGDLNHLVSVTMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAKGSQQYRALTVAELTQQMFDAKNMM
TACDPRHGRYLTVACIFRGPMSMKEVDTQMYNVQSKNSSYFVEWIPNNVKVAVCDIPPRG
LKMSATFIGNSTAIQEIFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLIS
EYQQYQEATADDEVEFDDEQAEQEGYESEVLQNGNGE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgagggaaattgtgcatctgcaggcgggccagtgcggcaatcagatcggttcgaagttc
tgggaaatcatctccgacgagcacggcatcgatcccaatggttactaccacggcgagtcc
gccctgcagcacgagcggatcgatgtttactacaacgaggccagcagcgggaagtacgtg
ccgcgagcggtgctcatcgacctggagccgggcaccatggactccgtccgccagtcgccg
gtgggccagcttttccggccagataacttcgtttacggacagtcgggagccggcaacaac
tgggccaagggccattacacagagggcgccgagctgatcgattccgtgctggaggtgctg
cgcaaggaatccgagggctgcgactgcctgcagggcttccagctggctcactcgcttggc
ggaggcactggctccggcctgggcacgctgctcatctcgaagattcgcgaggagtacccc
gaccgcatcatgaactccttctccgtggtgccatcgcccaaggtatccgacactgtcgtg
gagccgtacaatgccacgctgtccatccaccagctggtggagaacaccgacgagacattc
tgcattgacaacgaggctctctacgacatctgcttccgcacgctgaagctatcgtcgccc
acctacggcgatctgaaccatctcgtctccgtcacaatgtccggagtgaccacctgcctg
cgcttccctggccagctgaacgctgatcttcgcaagctggcggtgaacatggtgcccttc
ccgcgtctgcacttcttcatgcccggattcgctccgctgaccgccaagggatcccagcaa
tatcgcgccctcacggtggccgagctgacccagcaaatgttcgatgccaaaaacatgatg
accgcctgtgatccccggcacggacgctacctcaccgtggcctgcatcttccggggaccc
atgtccatgaaggaggtggacacgcagatgtacaacgtgcagagcaagaacagcagctac
tttgtcgaatggattcccaacaacgtcaaggtggccgtctgcgacatcccgccccgtggg
ctcaagatgtccgccaccttcattggcaactcgaccgccatccaggagatctttaagcgc
atctccgagcagttcactgccatgttccggcgcaaggccttcttgcactggtacaccggc
gagggcatggacgagatggagttcaccgaggccgagagcaacatgaacgatctgatatcc
gagtaccaacagtaccaggaggctaccgccgacgacgaagtggagttcgatgacgagcag
gccgagcaggaaggctacgagtcggaggtcctgcagaacggcaatggcgagtaa

DBGET integrated database retrieval system