KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5122Help
Entry
Dmel_CG5122       CDS       T00030                                 

Gene name
CG5122
Definition
(RefSeq) uncharacterized protein
  KO
K00624  carnitine O-acetyltransferase [EC:2.3.1.7]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dmel_CG5122 (CG5122)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.7  carnitine O-acetyltransferase
     Dmel_CG5122 (CG5122)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 34703
NCBI-ProteinID: NP_609601
FlyBase: FBgn0032471
UniProt: Q9VK40
LinkDB All DBs
Position
2L
AA seq 1263 aa AA seqDB search
MRVLLGTKCFANLCKHRIRWHHKSYLPPQQLYDVAKKVVRAHRLAFSLRFLSSKGKPPET
PTLDIICRVLASAKNSGENSGKRKEPLKFESVGQNSSCQTSTTNPLHIKGDSPKLPSKRQ
LEPDLVNLKTLEIFNCKNCFENSPEITIANCKNCIGDGHSQSVESVIGKATSLLLENSKT
ELASVLKKPSTSASKPSVGQSLPSVAPRKPADSPSSNSLNERFSMPQKSAFPIGRNPCFD
GKKAKKSKCPPPKPKSCPSSKDENKPPVKKKSKSKSKDPPKTVDSTAPDAQKKENASAKP
KIASPPPNKAQTDKSPENPKVGFNMPSNSAFPLGRNPCVDGKNEKKVSKGAATDSKPQQK
AKKPKVAAKSECKQEKKMASCPNASVSKKAATVPSGSPKSPESAAPKAEPRKKKSMRQGV
VNPSKPKSKKPASKAIKQPKDEGLPPVSTSRFSMPLMMAFPIGRNPCRDGPRGSSKKEEE
GPCGKKIVNDCHSASDSCQSKKNRSNAAKLERASSSLKTVSQKDFKQSDAATSVESHTAP
VSKASSQTSPPPTPVKEISMSALPSPKDPSISTVKAPLPSPIKDTKAPQAPQLSPSPSNK
EIKIATVEKIKSPKPLSKPQYSKRSNCEVKTQCAEKPQKVPKKCIKSEIRHLADANNDPN
KKPELKKFPALPLKQSIASYLSSIEPFLNEEELKVEQKVAKKFVDNEGAKLQQLLEEEAE
GTDNWLTPRWTRSAYLTYQAPLTVFSSPGLSFPIQEFKDTNDFLNFTAKAIYGMCEFKQL
VDQNKIPVVQMGKHQLDNSQFGKIFGTVRKPGRFCDTIEQYNDADYIVVVYNNNYFKLPI
YSQSGALLHAHTLRDALQDILECPIKVGKHFGLLTHDNRSNWAEAYTVLCRPHGNADTVE
TIEQSLFVVCLDNCVPTPKGEERIVQAHQLLHGGGVRQNSANRWMDKTIQLIVNPNGLAG
FCYEHSPADCQPLAMLMDFVQLKVTEPNYGCEGCEADKKVTSNLLKFQPVNECINLWLCQ
ARRNIQRIVSQLQMNVINFECYGKCFIKAQGLNPDSYIQMALSLAYYSMYGKIPAQYESA
HLRIFHEGRTETIRSTSNESKTFLLAMQSEKASMSEKLAALQKAVDAHEKLIKEAINGQG
IDRHLFGLQEMALEKGMPIPEFFRSKGYVRSVTFQLFTSQVATSNEGFMAYGPLLSDGYG
VCYNPKESKITFAISAWKSCKEINTIRFAKAIKKSLNDMRKLILLTGGERAGEHPCKCET
VLV
NT seq 3792 nt NT seq  +upstreamnt  +downstreamnt
atgagggtccttctaggcaccaaatgcttcgcgaacctctgtaagcaccggatacgatgg
catcacaagtcatatctaccgcctcagcagctctacgatgtagcaaagaaagtcgtcaga
gcgcaccgattagcattttccttgcgatttttatcaagcaaaggaaaaccaccggaaact
ccgactttggacataatttgccgcgtattagcgtcagcaaaaaactcaggtgaaaactca
ggcaagcggaaagagccattaaaatttgaatccgtgggtcaaaattccagctgccagaca
tcgacgacaaatccgcttcatataaaaggggacagcccaaagctgccatcaaaaagacaa
ttagaaccggatttagttaacttaaaaaccctagaaatattcaactgcaagaactgtttt
gaaaatagtccagagataacgattgccaactgcaaaaattgcattggagatggccatagt
caatctgtagagtcagttattggaaaggcgacatcactactattggaaaacagtaaaact
gaattggcaagtgttttaaagaagccttcaacatccgcatccaaaccatcggttggccaa
tctctaccatctgttgctccaagaaaacctgccgattccccaagctctaattctcttaat
gaaagattttccatgccgcaaaaatcagcttttccgattggaagaaatccctgttttgac
ggcaaaaaagctaaaaaatcgaaatgtccgccacccaaacccaaatcttgtccctcatcg
aaagatgagaacaagcctccagttaaaaaaaagtctaaatccaagtcaaaagatccacct
aaaacagttgattctactgcaccagacgcacagaaaaaagaaaatgcttccgcaaagcca
aagatcgcgagcccacctccaaataaagctcaaacagataaatcacctgaaaatccaaag
gttggttttaatatgccgtcgaattcggcttttccattgggaagaaacccttgcgttgat
ggtaagaatgagaaaaaagtatctaagggtgcggcaacggattccaagccacaacaaaaa
gccaagaagccgaaagttgcggcaaaaagtgaatgtaagcaagaaaagaaaatggcatct
tgcccaaatgcatctgtgagtaagaaagcagctactgttccaagtggttcacctaaatct
ccggaaagtgctgcaccaaaagccgaacctcgaaagaaaaagtcaatgaggcagggtgtt
gttaatccatcaaaaccaaagagtaagaaaccggcttctaaggctattaaacaaccaaaa
gacgaagggctaccaccggtgtcaacttcccggttttccatgcctcttatgatggcattt
cctattggaagaaatccttgccgggatgggccaaggggatcatccaaaaaagaagaagaa
ggtccttgcggtaaaaaaatagtcaacgattgccattcagcatccgattcctgtcaatct
aagaagaatagatcgaatgccgcaaaactggaaagagcatcaagttcattgaaaacggtt
tcgcaaaaagattttaaacaatctgatgcagcaacgtctgtagaatctcacaccgcacca
gtgtcgaaggcttcatcccaaacttcgccacccccaacaccggtcaaggaaatcagcatg
tctgctcttccttcccccaaagatccaagtatctcaacagttaaagcacccttgccatca
ccaattaaagacaccaaggcacctcaagctccacagctttcgccttcaccttctaataag
gaaatcaaaatagctacagtggaaaaaataaaatctccaaagccactttcaaagccccaa
tactcaaaaagatcgaattgcgaagtaaaaacacaatgtgctgaaaagccgcaaaaagtt
cccaagaaatgcataaaatcggaaattcgccacctagccgatgccaacaatgatccgaat
aagaaacccgagcttaaaaagtttccagctcttccgctaaagcaaagcatcgccagttat
ttaagcagtattgaaccatttcttaatgaggaggaactcaaagtggaacagaaggtggcc
aagaagtttgtggacaacgagggtgcgaaactccagcagcttctcgaggaagaagccgag
ggtacggacaactggctaactcccagatggacacgttccgcatatttgacctatcaggct
ccgctgaccgtcttctccagtccgggtctctcctttcccattcaggagtttaaagatacc
aatgattttctcaacttcacggccaaagctatctacggtatgtgcgagttcaagcagcta
gtcgaccaaaacaaaattccagtggttcagatgggtaaacaccaactggacaacagccag
tttggtaaaatctttggtacggttcgtaagccaggtcgattctgcgataccatcgaacag
tataatgatgccgattatattgttgtggtatataataataattactttaagttgccaatt
tattcccaaagtggagcattgttgcatgctcatacactgagagatgcgttgcaagatata
cttgaatgccccattaaagtgggcaaacactttggtcttttgactcacgacaatagaagc
aactgggcagaggcatatacagtactatgtcgtcctcacggaaatgcagataccgtggag
accatagagcagtccctgttcgtggtctgtctggacaactgtgtacccacgccgaaggga
gaggagcggattgtccaggcccatcagctcctgcacggtggtggagtgcgtcagaatagc
gccaatcgttggatggacaaaaccattcagctgatagtcaatccaaatggtttggccgga
ttttgttacgagcattcgcccgcggattgccagccacttgccatgctgatggattttgtg
cagttaaaagtcactgagccaaactatggctgcgaaggctgtgaggcggacaaaaaggtc
acgtccaacctgttaaaatttcagcctgtgaacgagtgcatcaatttgtggttgtgccag
gcaaggcgaaatatccagcggatcgtcagccagctgcagatgaatgtgatcaatttcgag
tgctacggcaaatgcttcattaaggcacagggtctgaatccggatagctacattcagatg
gccctaagtctggcctactactccatgtacggaaaaatacccgcacagtacgagtccgct
catttaaggattttccatgagggtcgcactgagaccattagatccacttccaatgaatcc
aagaccttcctactggccatgcaatcggagaaggcgtcaatgagcgagaaattggcagcg
cttcaaaaggccgtggatgcccacgaaaagttgatcaaagaggccattaatggacagggt
atcgatcggcatttgtttggcctgcaggagatggcactggaaaagggaatgccaataccg
gaattctttcggtccaagggttacgtccgatcggtgaccttccagctcttcacctcccag
gtagccacctccaatgaagggttcatggcatacggaccacttctatccgacggatatgga
gtgtgttacaatccaaaggaaagtaagatcaccttcgccatctccgcttggaaaagttgc
aaagaaatcaacaccatacgattcgcaaaagccatcaaaaagtccctaaacgacatgaga
aaactaatcctgctcactggaggtgaacgtgcgggcgaacatccatgtaaatgcgaaaca
gtgctggtctag

DBGET integrated database retrieval system