KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5265Help
Entry
Dmel_CG5265       CDS       T00030                                 

Gene name
CG5265
Definition
(RefSeq) uncharacterized protein
  KO
K00624  carnitine O-acetyltransferase [EC:2.3.1.7]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dmel_CG5265 (CG5265)
Enzymes [BR:dme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.7  carnitine O-acetyltransferase
     Dmel_CG5265 (CG5265)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 42074
NCBI-ProteinID: NP_650605
FlyBase: FBgn0038486
UniProt: Q9VEM4
LinkDB All DBs
Position
3R
AA seq 643 aa AA seqDB search
MKFRDNGKVLWNFARISALQQTRYTFGKKMPIASYSTAKDKPKSDQPNLLKYHVLPLEEI
LNRFMITVQPLLTPEEFKKQEKITNEFQRKEGAKLQKLLEETGEQEKNWLAHRWLKVAYL
QFRSPVTCFSSPGMTFPKQKFESVHEFVDYTSRVIFGLGEFNDLVHAKKIPIVKMGKNEL
DNSQFGKVFGTCRIPRRFTDDIVYNPCSDYVVVIYRNHFYQLKIYDKEGKLIIAPCLAVQ
LEEIMAKEKEPGVPYGILTTDSRDNWAEAYEHLSNTPRNRVALKTIQNAMFTVSLDECTS
PKEGRDAEELILTLIHGKGSKCNSANRWMDKTIQLVVNPNGHVGFTYEHSPAEGQPIAMM
MDYVVKKMKDDPSYGECGSENFIPAKKIKFCDVSKCVEQWLIIAQKNVDKLVQDLQMKVL
KFDCYGKDFIKKQRLGPDSFVQMALQLAFFKLHYEPAAQYESAHLRIFDGGRTETIRSCS
NESLAFCHAMDDVSASAQERASKIREAVMCHQMYAKLALLGKGVDRHLFGLKLMAVENCL
PVPEFFSSPGYVKSTHFRMSTSQVATKYDAFMGYGPSVEDGYACCYNPREHDIILAISAW
RHCQATDHQKIAKALAQSFAEMKDVLETCPASKDKPPELKCKY
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgaagttccgtgacaatggaaaggtcctttggaatttcgcaaggatatcggctctgcaa
cagactcgatatacgttcggcaaaaaaatgccaattgccagctatagcactgccaaggat
aagcctaaatccgatcagccaaaccttctaaagtatcatgtcttacctcttgaagaaatc
ctcaaccgcttcatgattaccgtacaaccattgctgacacccgaggagttcaaaaagcaa
gagaagattactaacgaattccagaggaaggagggcgctaagctacaaaagctcctcgaa
gaaactggtgaacaggagaagaactggttagcccatcgctggctgaaggttgcctactta
cagtttcggtcgccagtgacttgcttctccagtcccggcatgacctttcccaaacagaaa
tttgaaagtgtccacgaatttgtggactacacgtctagggttatcttcggtttgggtgag
ttcaatgacttggtgcacgccaaaaagattccgattgtgaaaatgggcaagaacgagctg
gacaacagtcagtttggaaaggttttcggcacatgccggataccgagaaggtttaccgac
gatatcgtctacaatccgtgctctgattatgtggtggttatctaccggaatcacttttat
caactgaaaatatacgacaaggaaggaaagcttataattgcaccatgtctggctgttcaa
ctggaggaaataatggcaaaggaaaaggaaccgggagttccttatggaatcttgaccacc
gattcgcgggacaactgggccgaggcatacgaacacttgtcaaatacgccccgtaataga
gttgccctgaaaaccattcagaatgctatgttcacagtgtccctcgacgagtgtaccagt
ccaaaagaaggtcgagatgccgaagaattgatccttacgctgatccatggaaagggcagc
aagtgcaacagtgccaaccgctggatggataagacaattcaattggtggtaaacccaaat
ggacacgttggattcacctatgagcactcaccagccgagggccaaccgatcgcaatgatg
atggactatgtagtgaagaagatgaaggatgaccctagttatggggaatgcggatcggaa
aactttattccagcgaagaaaataaagttctgtgatgtaagcaaatgcgtggagcaatgg
ttgataatcgcgcaaaaaaacgtggacaaacttgtccaggacctgcaaatgaaggttctt
aagttcgattgctacggcaaggatttcatcaagaaacagcgacttggtccagatagcttt
gttcagatggcattgcagttggcattctttaaattgcactatgagccagctgctcaatat
gaatcggcgcatttgcgcatcttcgatggcggccgaaccgaaaccatccgttcgtgctcc
aatgaatccctggctttttgccacgccatggatgatgtgagtgcatcagctcaggagcgg
gctagtaagattcgcgaggcagtgatgtgccatcagatgtatgcgaagctggcgcttctg
ggaaagggtgtcgatcgtcacctctttggacttaaactaatggcggtggagaactgccta
cctgttccggagttcttctcttcgccaggatatgtaaagtccacgcactttcgaatgtcc
acttcgcaggtggccaccaaatatgatgccttcatgggatatggaccttctgtagaagat
ggatatgcctgttgctacaatccccgtgaacatgacatcattttggccatatccgcatgg
cgacattgtcaggcaactgatcaccaaaagatcgccaaggcgcttgcgcagtcctttgct
gaaatgaaggatgtacttgaaacatgtccagcttcaaaagacaagccgccagagcttaag
tgcaagtattga

DBGET integrated database retrieval system