KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5292
Entry
Dmel_CG5292       CDS       T00030                                 

Symbol
CG5292
Name
(RefSeq) uncharacterized protein, isoform B
  KO
K15441  tRNA-specific adenosine deaminase 2 [EC:3.5.4.-]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dme03016]
    Dmel_CG5292 (CG5292)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     Dmel_CG5292 (CG5292)
Transfer RNA biogenesis [BR:dme03016]
 Eukaryotic type
  tRNA modification factors
   Deaminases
    Dmel_CG5292 (CG5292)
SSDB
Motif
Pfam: dCMP_cyt_deam_1 MafB19-deam SNAD4 NAD2 APOBEC4_like APOBEC1 Bd3614-deam APOBEC2 NAD1
Other DBs
NCBI-GeneID: 42079
NCBI-ProteinID: NP_001262661
FlyBase: FBgn0038491
UniProt: Q9VEM0
LinkDB
Position
3R:17151861..17153771
AA seq 160 aa
MAAFMEEALVEARRARDAGEVPVGCVFVHGDKVVARGGNEVNVHRNATRHAEFICIDAIL
ASCRERRLPARQLFSEITVVVTVEPCIMCSAALHTLGVKEIIYGCENDRFGGKTVVDVAA
VVGHRIEITGGVRADEAMALLKDFYKGDNPAAPPQAKKKK
NT seq 483 nt   +upstreamnt  +downstreamnt
atggccgccttcatggaggaagcgttagtggaggcgaggcgggcacgtgacgccggcgag
gtgcccgtgggctgtgtgttcgttcatggggacaaggtggtcgcacgtggcgggaacgag
gtgaacgtccaccggaacgccactcgccacgcggaattcatttgcatcgacgctatcctc
gccagctgccgcgagagacgtctgccggcccgccagctgttcagcgagatcaccgtggtg
gtcaccgtggagccctgcattatgtgctccgccgccctgcacactctgggcgtcaaggag
atcatctacggctgtgagaacgatcgtttcggaggaaagacggtcgtggatgtggccgcc
gtcgttggccataggatcgagatcacgggcggtgtgcgggcggatgaggcgatggctctg
ctaaaggatttctacaagggcgacaatccggcggcaccgccacaggccaagaagaaaaag
tag

DBGET integrated database retrieval system