KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5370
Entry
Dmel_CG5370       CDS       T00030                                 

Gene name
Dcp-1
Definition
(RefSeq) death caspase-1
  KO
K20008  death caspase-1 [EC:3.4.22.-]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04214  Apoptosis - fly
dme04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG5370 (Dcp-1)
   04215 Apoptosis - multiple species
    Dmel_CG5370 (Dcp-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG5370 (Dcp-1)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     Dmel_CG5370 (Dcp-1)
Peptidases and inhibitors [BR:dme01002]
 Cysteine peptidases
  Family C14: caspase family
   Dmel_CG5370 (Dcp-1)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 37729
NCBI-ProteinID: NP_476974
FlyBase: FBgn0010501
UniProt: O02002
LinkDB
Position
2R
AA seq 323 aa
MTDECVTRNYGVGIRSPNGSENRGSFIMADNTDAKGCTPESLVVGGATAASPLPANKFVA
RMPVERYASEYNMSHKHRGVALIFNHEFFDIPSLKSRTGTNVDAQELKKAFENLGFAVSV
HKDCKLRDILKHVGKAAELDHTDNDCLAVAILSHGEHGYLYAKDTQYKLDNIWHYFTATF
CPSLAGKPKLFFIQACQGDRLDGGITLEKGVTETDGESSTSYKIPIHADFLFSYSTIPGY
FSWRNINNGSWYMQSLIRELNANGKKYDLLTLLTFVNQRVALDFESNVPATPMMDRQKQI
PCLTSMLTRILRFGDKPNGNKAG
NT seq 972 nt   +upstreamnt  +downstreamnt
atgaccgacgagtgcgtaaccagaaactacggagtaggcattcgcagcccaaatggatcg
gaaaatcggggcagctttataatggctgataataccgatgccaagggctgtacgccggag
tctcttgttgttggtggtgcaactgcagcgagccccttgccggccaacaagtttgtggct
cgaatgcccgtggaacgatatgcaagcgaatacaacatgagtcacaagcaccgcggagtt
gcgctgatcttcaaccacgaattcttcgacataccctcgctgaagagccgcaccggaaca
aatgtcgatgcccaagagctgaaaaaggcctttgaaaacctgggattcgcggtgtccgtg
cacaaggactgcaagttgagggacatcctgaagcacgtggggaaggccgccgagttggac
cacacggacaacgactgccttgcggtggccatactctcgcacggggagcacggctacctg
tacgccaaggatacgcagtacaagctggacaacatctggcactacttcactgccaccttc
tgcccctcgctggcgggcaagccgaagctgttcttcatccaagcctgccagggcgatcgc
ttggacggaggcatcactctggagaagggcgttaccgagacggacggggagtcctcgacg
agctacaagatacccatacacgccgactttctcttctcctactcgaccattccgggctac
ttctcctggcgcaacatcaacaatggctcctggtacatgcaatcgctgatccgcgagctg
aacgccaatggcaaaaagtacgacctgctcaccctgcttacattcgttaaccagcgcgta
gccctagactttgagtcgaacgtgcccgccacaccgatgatggatcgccagaagcaaata
ccgtgcctcacctccatgctgacgcgcatactgcgcttcggcgacaagccgaacggcaat
aaggctggctag

DBGET integrated database retrieval system