KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5507
Entry
Dmel_CG5507       CDS       T00030                                 

Gene name
T48
Definition
(RefSeq) transcript 48, isoform B
Organism
dme  Drosophila melanogaster (fruit fly)
SSDB
Motif
Pfam: GF_recep_IV EphA2_TM
Other DBs
NCBI-GeneID: 43235
NCBI-ProteinID: NP_001262999
FlyBase: FBgn0004359
UniProt: Q9VBA5
LinkDB
Position
3R
AA seq 419 aa
MRSVEVAQSGPSAIFWLVQVLIVGAAQAATPFAKEYRNAGLYNGNTLVDLDGSTTLDMGQ
EKPTSSSSGLSGGFKSESSVVLPGMLQNSGCPLTTSSHCLRCNKVGCIKCPMYLVTDTRQ
CVDQCPAGYLDQWSAHTEFMGRVCVPTGYSGPLMAALAGLLGGFLVCLSLLAVAVMLVKR
KRRRKSIKQKLINENTMDRADFMRQLNEMRPNAEYFLAMLNDTRRQIRKLYLSGEVAAAN
SYRPIVRDLAKLLILLNRPIELIPAPPPDWSRLYAWSEQALERYKPQVGQLIDFFQASHG
HSAGHHEVLYAAPNKKKQLQQPSIFRQQVTPTATPQGVGELMAGDRSSSASAQQKLHLFG
SLISLHEFEEPRASDPFGSSFNTLKSGNLISDLNASSLWLEDEFYKLGFRPQDEITTEL
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgcggtcggtggaagtggcccaaagcggcccatctgccatcttctggctcgtccaagtg
ctaatcgtgggggcggcacaggctgccacgcccttcgcgaaagagtaccgcaacgcggga
ctctacaatggcaacacactcgtcgatctggacggttccaccaccctggacatgggccag
gagaagcccaccagcagcagcagcggtctcagtggaggcttcaagtcggagtcgtcggtg
gtgctgcccggcatgctgcaaaattcaggctgcccgctgacgacgagttcccactgcctg
cgctgcaacaaggtgggctgcatcaagtgcccaatgtacctggtgacggacacgaggcag
tgcgtggatcagtgccccgccggctacttggaccagtggtccgcccacacggagttcatg
ggtcgggtgtgtgtacccaccggctattctgggccactgatggccgcactggccggactt
ctcggtggcttcctcgtttgcctgtcccttctggctgtcgccgtgatgctggtcaagagg
aagaggcggcgaaagtccatcaaacagaagctcatcaacgagaacaccatggatcgggcg
gacttcatgaggcagctaaacgagatgcgtccgaatgcggagtactttctggccatgctg
aacgatacccggcggcagatcaggaagctctatttgtcgggtgaagtggcggctgccaac
tcgtacaggcccatcgtccgggatctggcaaagctgctgattctgctaaacaggcccatt
gaactgattcccgccccgccgccagattggtccaggctttatgcctggtcggagcaggcc
ctggagcgttacaagccgcaggtgggccagcttatcgacttctttcaggcctcacacggt
cacagtgctggccaccacgaggtgctctacgctgcgccgaacaagaagaagcaactgcag
cagcccagcatcttccggcaacaggtgacgcccacggcgacgccgcagggagtgggcgaa
ctgatggccggcgatcggagcagcagtgcctcggcgcagcagaagctacacctgtttggc
tcgctgatcagcctgcacgagttcgaggagccgcgggcttcggatcctttcggcagcagt
ttcaacacgctgaagagcggcaatctcatctctgatctcaacgccagctcgctgtggctg
gaggacgagttctacaagctgggctttcgaccgcaggacgagatcaccacggagctgtaa

DBGET integrated database retrieval system