KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5603
Entry
Dmel_CG5603       CDS       T00030                                 

Gene name
CYLD
Definition
(RefSeq) cylindromatosis, isoform E
  KO
K08601  ubiquitin carboxyl-terminal hydrolase CYLD [EC:3.4.19.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG5603 (CYLD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG5603 (CYLD)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG5603 (CYLD)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmel_CG5603 (CYLD)
Peptidases and inhibitors [BR:dme01002]
 Cysteine peptidases
  Family C67
   Dmel_CG5603 (CYLD)
Ubiquitin system [BR:dme04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dmel_CG5603 (CYLD)
SSDB
Motif
Pfam: CAP_GLY UCH RNHCP HARE-HTH
Other DBs
NCBI-GeneID: 34380
NCBI-ProteinID: NP_609371
FlyBase: FBgn0032210
UniProt: Q8IPC5
LinkDB
Position
2L
AA seq 639 aa
MNSKSDYEAEKEKKLTITNRFGDSLENYELSNESEHKTHVYPKKIPNRKNGILKNTDANH
SAVDNQHLEDVDLADILGTNWPKRAGPAAMILNNKSKTDPSNSVDLILKPASPILKIEPE
EPLRFTIADYQPLIEIPGTELAIGSLVEVSNPGVCEDLYGVVRWIGIPPGPQKNVLVGIE
VEDESNLKNVVASDGRHNGVRLFTCHDGRAIFVPANRCTADRRFADVDNSISANRVSSNH
AKKFGVADCPAIYGSIPPLQIHNSDELASICGKFKGIQGHHNSCYLDATLFSMFTFTSVF
DSILYRRPGPQDIRNYSEVQKVLRDEIVNPLRKNVFVRSDRVMKLRELLDQLSSVSGLTC
EEKDPEEFLNSLLSQIMRVEPFLKLSSGQDSYFYQLFVEKDEKLTLPSVQQLFEQSFHSS
DIKLKEVPSCFIIQMPRFGKNYKMYPRILPSQVLDVTDIIENSPRQCSLCGKLAEYECRD
CFGSLQAGSGLECTAFCPKCLKTFHSHIKRTNHVSKKIYSPKEFKIMAEHMVVPRLYMEL
FAVVCIETSHYVAFVKSGSGPDAPWCFFDSMADRKGEQNGYNIPEITCVPELTQWLSEEG
ARSINETSTNDKVLPEHAKRIFCDAYMCLYQSTDIMMYH
NT seq 1920 nt   +upstreamnt  +downstreamnt
atgaattccaaatccgattatgaagcagaaaaagaaaaaaagctgaccataacaaataga
ttcggggactccctggaaaactatgaactatccaacgagagcgagcacaagacccatgta
tacccgaaaaagattcctaacagaaaaaacggaattttaaaaaacaccgatgccaaccat
agtgccgtcgataatcaacatcttgaggatgtggatttggcagacattttgggcacaaat
tggccaaaacgagcgggaccagctgcaatgatcttaaacaacaaaagtaaaacggatcct
agtaattctgtagacttaattttaaaaccagcctcacccatattaaaaatagagccggag
gaacctttacgttttacaatcgctgattatcaacctctgattgaaatacctggaaccgag
ctagcgattggttccctcgtcgaagtctcgaatcctggagtatgtgaagatctatatggc
gttgtgagatggataggtataccgcctggcccgcaaaaaaacgtactcgtcggaatcgag
gtagaagacgaatccaacttgaaaaatgtagtggcatcggatgggagacacaatggcgta
cgcttatttacttgccatgatggtcgagctatttttgtaccagccaacagatgcaccgct
gaccggcgatttgctgatgtagataatagcatttctgcaaacagagtttctagtaatcac
gcaaagaaatttggcgtcgctgactgtcctgccatatatggctcgataccaccattacaa
atacacaattccgatgagcttgctagcatatgtggaaagttcaaaggaatacaaggacac
cataattcctgctaccttgatgcaactctattttccatgttcactttcaccagtgttttc
gattcaattctgtacagacgtccgggcccacaagatattcgaaattacagtgaggttcaa
aaggttctgcgcgatgagatcgtcaatccattgcgaaaaaacgttttcgttcgatccgat
cgtgtgatgaaactgcgcgagctcctagatcagctaagttcggtcagcggtctcacctgc
gaggaaaaggatcctgaagagttcctaaatagtttgctctcacaaataatgcgagttgaa
ccgtttctaaagctaagctcggggcaagattcttatttttaccaactctttgtggagaag
gatgagaagttaacattaccgagtgtgcaacaattgtttgagcaaagctttcactcatcg
gatataaaactaaaggaggttccttcttgtttcatcattcaaatgcctcgtttcggaaag
aactacaagatgtatccaaggatattgccatcgcaggttcttgatgtcacagacataatt
gaaaattctcctcgacagtgctcactttgtggcaaactagctgaatacgagtgccgggat
tgctttggcagcttgcaggctggatcaggactggaatgcaccgccttttgtccaaaatgt
ctcaagacatttcacagtcacatcaaaagaacgaatcatgtgtcgaagaagatttatagt
ccgaaggaatttaaaatcatggccgagcacatggttgtcccgcgattgtacatggagtta
tttgcagtcgtttgcatagaaacatctcactacgtggcatttgtcaagtctggatccgga
ccagatgctccatggtgtttcttcgattcaatggctgatcgaaaaggcgaacagaatgga
tacaatatacctgaaattacgtgtgttccagaattaacacagtggctctcggaagaaggc
gcacgatctataaatgaaacttcaacgaacgataaagtattacctgaacacgccaagcgt
attttttgcgatgcctatatgtgtctgtaccaaagcacagatataatgatgtaccattag

DBGET integrated database retrieval system