KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5656
Entry
Dmel_CG5656       CDS       T00030                                 

Gene name
Alp1
Definition
(RefSeq) alkaline phosphatase 1, isoform B
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00730  Thiamine metabolism
dme00790  Folate biosynthesis
dme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Dmel_CG5656 (Alp1)
   00790 Folate biosynthesis
    Dmel_CG5656 (Alp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG5656 (Alp1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dme00537]
    Dmel_CG5656 (Alp1)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Dmel_CG5656 (Alp1)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG5656 (Alp1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:dme00537]
 Enzymes
  Dmel_CG5656 (Alp1)
SSDB
Motif
Pfam: Alk_phosphatase
Other DBs
NCBI-GeneID: 40372
NCBI-ProteinID: NP_001262159
FlyBase: FBgn0283479
UniProt: M9PD70
LinkDB
Position
3L
AA seq 530 aa
MRALRFFAALALQLTACSSQYKYGPEQSWDLDSISELKSKEFWFHDAQRTLYNKLSTPPN
QYRAKNVIFFLGDGMSVPTVTAGRIFDGQLRGVVGERNRLEFEKFNYVGLSKTYCVNKQV
ADSACTASAYLSGIKANYLTIGVTADVELNDCRGSRLPQNRLSSIAAWALKGSKSAGLVT
TTRVTHASPAGVYAHTSNRDFESDYDVTKLGQNPGNCPDIAQQLIDGDVGKRLRVVMGGG
TIKFLPNTTNDVFGNKGQRLDNRNLIEEWQQTKPGNARVVFSRTDLLNNDAQNTDFLLGL
FNASHLAYHMDDSIDTPTLPEMTAAAINVLSRDPNGYFLFVEGGRIDHAHHETKAKKALD
ETVQFSDAVRKARQLTNPWDTLIVVSADHGHTVTISGYPDVNNSIVGLNSELSNVDQLPY
TSISYANGPAYERFYKSTDGVVERVDLRNLDFSKPDAIYPHGVPMTEETHGGGDVAVYAH
VVEYLLQGPWSHLFTGVYEQSTLPHLMGFASCLGPGITYCDLQPKARYSP
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgcgtgctctccggttctttgcggctcttgccctccaactcacggcctgtagcagccag
tacaaatatgggccagagcaatcctgggacctcgactctatttccgagttgaagagcaag
gagttctggtttcacgacgcccagcgcacgctctacaataagctatccactccaccaaac
caatatcgtgccaagaatgtcatatttttcctgggcgacggtatgtccgttcccacggta
accgcaggcaggatcttcgatggacagctgcgtggagtggtgggcgaacggaatcgtctg
gagttcgagaaattcaactatgtcggtctgtccaagacttattgcgtcaataagcaagtg
gctgactccgcctgcacagcatcggcctatctgtcggggatcaaggcgaactatctgacc
atcggagtgacagccgatgtggagttgaacgactgcaggggatcgcgcttgccgcagaat
aggctctcctcgattgccgcctgggcgcttaaaggtagcaaatccgctggattggtgacc
accactcgggttacccacgccagtccggccggagtttatgcgcacacttcgaatcgcgat
ttcgagagcgactacgacgtgaccaaattgggtcaaaatccaggaaactgtccggatatc
gcccagcaattgatagacggagatgtgggcaagcgactgcgtgtggtcatgggcggtgga
accattaaattcttgcccaataccacgaacgatgtgttcggaaacaagggccagcggttg
gataataggaacctcattgaggaatggcaacaaacaaagccgggtaatgctagggtggtg
tttagtcgtacggatctcctgaacaatgatgcgcagaacactgacttcctgctggggctc
ttcaatgcctctcacttggcgtaccacatggacgacagcatagacacacccacgctaccc
gagatgacggcagcggccataaatgtgctttcccgagatccaaacgggtatttccttttc
gtggaaggcggtcgaatcgatcacgcccatcatgagaccaaggccaagaaggccttggat
gaaaccgttcagttttcggacgcagtgagaaaggcacgacaactcaccaatccctgggac
accttaattgtggtgagtgcggatcacggacacacggtcacgatcagcggctatccggat
gttaacaacagcatagtaggactcaattccgagctaagtaatgtggaccagctgccctac
acgtccatctcatatgccaacggcccggcctacgagagattctacaaatcgacggacgga
gtggtggagcgcgttgatctccgtaacctggacttttccaaaccggatgccatctatcca
catggagtgcccatgaccgaggagacacacggcggtggcgatgtggccgtctatgctcat
gttgtggaatatcttcttcaaggtccatggtctcatcttttcactggagtttacgaacaa
agcaccttgcctcatttgatgggcttcgcctcttgcttaggacctggaattacatattgc
gatctgcagccaaaagcaagatactctccctag

DBGET integrated database retrieval system