KEGG   Drosophila melanogaster (fruit fly): Dmel_CG5718Help
Entry
Dmel_CG5718       CDS       T00030                                 

Gene name
SdhAL
Definition
(RefSeq) succinate dehydrogenase, subunit A (flavoprotein)-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00020  Citrate cycle (TCA cycle)
dme00190  Oxidative phosphorylation
dme01100  Metabolic pathways
dme01200  Carbon metabolism
Module
dme_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dme_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dme_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dmel_CG5718 (SdhAL)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Dmel_CG5718 (SdhAL)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Dmel_CG5718 (SdhAL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 FAD_binding_3 GIDA HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 39348
NCBI-ProteinID: NP_648523
FlyBase: FBgn0036222
UniProt: Q8SX97
LinkDB All DBs
Position
3L
AA seq 651 aa AA seqDB search
MNRLFLKRAGQHVTRSLLGPNGSRLLQVSCVRDASCKDEYSLIDHKFDAIVIGAGGAGMR
AGFGLAEKGFQTAIISKLFPTRSHTVAAQGGVNAALSNMDKDDWKYHFYDTVKGSDWLGD
QNAIHYMCREAERAVCELDMYGMPFSRKPDGKIYQRPFGGQTLDYGKGGVARRACACADR
TGHALIHTLYGQTLKHSDSCHYFVDYFVLDLIMSQGACVGCLAWKLDDGTFHRFLAKNTV
VAAGGCGRVYFSTTAGHTCTGDGNAWVSRQELPLMDMEFVQFHPTGIYGAGCLITEGVRG
EGGFFLNCKGERFMERYAPKAKDLASRDVVARAMTMEVLAGNGCGPLKDHVHLQLHHIDA
KIIKQRLPGIMVTARIFAKVDVTKEPVPVLPTVHYNMGGIPTDYKGRVVTIDENGKEQVV
KGLYSCGETSCASVHGANRLGANSLLDLIIFGRVCALDIAANNCPGDKPPQVEDKATEKS
LDNFKRLRCADGCIPTAVLRMELQRTMTKHAAVFREGKLLKEGLLKVAELCEQFKDIKTT
DRTMVWNSNLVETLELQNMLANAVHIITAMENRKESRGSHAREDFKTRVDELDYGAPLAG
QKKKPFEEHWRKHTMTFALGNKGCASIKYRPVVDTTLDSSVAPIPPAPRTY
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgcctgtttctcaaaagggcgggacagcatgtaaccaggagccttcttggtcca
aatgggagtcgtctgcttcaagtgtcctgcgttcgagatgccagttgcaaagatgagtac
tccttgatagaccacaagttcgatgcgattgtcattggtgccggtggagctggaatgcgg
gctggatttgggctggcggagaagggtttccaaacggccattatatcaaagctatttccc
acccgatctcacacggtggctgcccagggtggtgttaatgccgccctctcaaatatggac
aaggacgactggaagtaccacttctacgacacggtgaagggctccgattggctgggtgat
cagaacgcgatccattacatgtgtcgggaggcggagagggcggtctgcgaactggacatg
tacgggatgcccttctcgcgaaagcccgatggcaagatctaccagcgaccttttggaggt
cagaccttggactacggaaagggcggggtggccagaagggcgtgtgcatgtgcagatcgc
acgggtcacgcccttatccacacactgtacggacaaacgctgaagcactccgattcttgc
cactattttgtggactacttcgttctggatctgatcatgtcgcagggtgcatgtgtggga
tgtttggcttggaaactggatgatggcaccttccatcggtttttggccaaaaatacggtt
gttgccgccggcggttgtggtcgggtgtacttctccacgaccgccggacacacatgtacc
ggcgatggcaatgcgtgggtgtctagacaggagctgccgctcatggatatggaatttgtg
cagtttcatcccactggcatctacggagccggatgccttatcaccgagggagttaggggc
gaaggcggtttcttcttgaactgcaagggagaacgtttcatggaacgctatgctccaaag
gccaaggatctggcgtccagagatgtggtggcgcgggccatgaccatggaggttcttgct
ggcaatggttgtggtccgctcaaggatcatgtgcaccttcagctccaccatatcgacgcc
aagatcatcaagcaacgattgccgggcattatggtcaccgcccggatttttgccaaagtg
gatgtgaccaaggaaccagtaccagtgctgccaactgtgcactacaacatgggcggcata
ccaacggattacaagggtcgtgtggtcaccatcgatgagaatggcaaggaacaggttgtc
aagggactgtactcctgcggggaaacttcctgcgcctcagtacacggagcaaatcgattg
ggtgccaactccctgctggatctgatcatctttggccgcgtctgtgctctggacattgcc
gcaaacaactgtccgggggataagccgccccaggtggaggacaaagccacggagaagtcg
ctggataattttaagcgcctgcgctgcgccgacggatgcattcccactgcggtgttgaga
atggaacttcagcggaccatgaccaaacatgcggctgttttccgggagggaaaactgctc
aaggagggtctgctcaaagtggccgagttatgtgaacagttcaaggacatcaagacaacc
gatcgtacgatggtgtggaactccaacctagttgagacgctagagctgcagaatatgcta
gccaatgcggtgcacatcattacagccatggaaaatcgcaaggagtcgaggggctcccat
gctcgcgaggatttcaagacgcgcgtggatgagctggactatggagcaccactggccgga
cagaaaaagaaaccattcgaggagcattggcgcaagcacaccatgacctttgcactgggt
aacaaaggatgtgcatcgatcaaatatcgcccggttgtggacaccaccttggacagctcc
gttgcacccattccacctgctccgcgcacctactga

DBGET integrated database retrieval system