Drosophila melanogaster (fruit fly): Dmel_CG5915 Help Entry Dmel_CG5915       CDS       T00030                                  Symbol Rab7 Name (RefSeq) Rab7, isoform B   KO K07897   Ras-related protein Rab-7A Organism dme  Drosophila melanogaster (fruit fly) Pathway dme04137   Mitophagy - animal dme04140   Autophagy - animal dme04144   Endocytosis dme04145   Phagosome dme04148   Efferocytosis Brite KEGG Orthology (KO) [BR:dme00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     Dmel_CG5915 (Rab7)    04145 Phagosome     Dmel_CG5915 (Rab7)    04140 Autophagy - animal     Dmel_CG5915 (Rab7)    04137 Mitophagy - animal     Dmel_CG5915 (Rab7)    04148 Efferocytosis     Dmel_CG5915 (Rab7)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:dme04131]     Dmel_CG5915 (Rab7)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:dme04147]     Dmel_CG5915 (Rab7)    04031 GTP-binding proteins [BR:dme04031]     Dmel_CG5915 (Rab7) Membrane trafficking [BR:dme04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     Dmel_CG5915 (Rab7) Exosome [BR:dme04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Dmel_CG5915 (Rab7)   Exosomal proteins of other body fluids (saliva and urine)    Dmel_CG5915 (Rab7)   Exosomal proteins of colorectal cancer cells    Dmel_CG5915 (Rab7)   Exosomal proteins of bladder cancer cells    Dmel_CG5915 (Rab7) GTP-binding proteins [BR:dme04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     Dmel_CG5915 (Rab7) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase AAA_16 nSTAND3 SRPRB Septin TniB AAA_24 PduV-EutP ATPase_2 Motif Other DBs NCBI-GeneID:  42841 NCBI-ProteinID:  NP_001247276 FlyBase:  FBgn0015795 UniProt:  O76742 LinkDB All DBs Position 3R Genome browser AA seq 207 aa AA seqDB search MSGRKKSLLKVIILGDSSVGKTSLMNQYVNKRFSNQYKATIGADFCTKEVVVNDRVVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNSFKNLDSWRDEFLIQASPRDPDHFPF VVLGNKVDLDNRQVSTRRAQQWCQSKNDIPYYETSAKEGINVEMAFQVIAKNALELEAEA EVINDFPDQITLGSQNNRPGNPDNCQC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgtccggacgtaagaaatccctactgaaagtcatcattctgggcgacagcagtgtgggc aagacctctctgatgaatcagtatgtaaacaaacgcttctccaaccaatacaaagccacg atcggagctgatttctgcacgaaagaggtggtggtcaacgaccgagtggtcacaatgcag atctgggacactgctggtcaggaacgcttccagtcgcttggagtggcgttttaccgcgga gccgactgctgcgtgcttgtctacgatgtgacggcgcccaactcgttcaagaatctcgac tcctggcgcgacgagttcctcatacaggccagtccacgggatcccgatcacttccccttc gttgtgttgggcaataaggtggatttggacaaccgccaggtgtccacgcgtcgagcgcag caatggtgccaatctaagaacgatataccctactacgaaacgtccgccaaggagggcatc aacgtggagatggcgtttcaagttatagccaagaatgcgttagagttggaggcggaggct gaagttatcaacgatttccccgatcagattaccttgggctcgcaaaacaatcgtcctggc aatcctgacaactgtcagtgctaa

DBGET integrated database retrieval system