KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6050Help
Entry
Dmel_CG6050       CDS       T00030                                 

Gene name
mEFTu1
Definition
(RefSeq) mitochondrial translation elongation factor Tu 1, isoform B
  KO
K02358  elongation factor Tu
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:dme03012]
    Dmel_CG6050 (mEFTu1)
   03029 Mitochondrial biogenesis [BR:dme03029]
    Dmel_CG6050 (mEFTu1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dme04147]
    Dmel_CG6050 (mEFTu1)
Translation factors [BR:dme03012]
 Eukaryotic Type
  Elongation factors
   Dmel_CG6050 (mEFTu1)
 Prokaryotic Type
   Dmel_CG6050 (mEFTu1)
Mitochondrial biogenesis [BR:dme03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Dmel_CG6050 (mEFTu1)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Dmel_CG6050 (mEFTu1)
  Exosomal proteins of breast cancer cells
   Dmel_CG6050 (mEFTu1)
  Exosomal proteins of colorectal cancer cells
   Dmel_CG6050 (mEFTu1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-GeneID: 44438
NCBI-ProteinID: NP_001163144
FlyBase: FBgn0024556
UniProt: A1Z9E3
LinkDB All DBs
Position
2R
AA seq 489 aa AA seqDB search
MSHAFAAAVCRSTASMSLALRCSRRAMSSARMLRMAGATATSTACKDWQRNGLLAAPRTG
NMQQYLREYANEKKVFERTKPHCNVGTIGHVDHGKTTLTAAITKVLADKQLAESKKYNEI
DNAPEEKARGITINVAHVEYQTETRHYGHTDCPGHADYIKNMITGTAQMDGAILVVAATD
GAMPQTREHMLLAKQIGIDHIVVFINKVDAADEEMVDLVEMEIRELLTEMGYDGDKIPVV
KGSALCALEDKSPEIGKEAILKLLQEVDSFIPTPVRELDKPFLLPVENVYSIPGRGTVVT
GRLERGVVKKGMECEFVGYNKVLKSTVTGVEMFHQILEEAQAGDQLGALVRGVKRDDIKR
GMVMCKPGSVKALDQLEAQVYILSKDEGGRTKPFMSFIQLQMFSRTWDCAVQVQIPDKEM
VMPGEDTKLILRLIRPMVLEQGQRFTLRDGNLTLGTGVVTSTLPPLTESQRSELTEGKKA
REKKVAAKK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatgcatttgccgccgccgtctgccggtccaccgcatccatgtcattggccctg
cgctgcagccggcgcgccatgagctctgccagaatgctgcgtatggcgggtgccactgcc
acctccacggcctgcaaggattggcagagaaacggactacttgctgcgcccagaaccggc
aacatgcagcagtacctgcgcgagtacgccaacgagaagaaggtgttcgagcgaaccaag
ccccattgcaatgtgggcaccattggccatgtggatcacggcaagaccacgctcacggcg
gccattaccaaggtcctggccgacaagcagctggccgagagcaagaagtacaatgaaatc
gacaatgcgcccgaggagaaggctcgtggtattaccatcaatgtagcccacgtggagtac
cagacggagacgcgtcactacggccacacagattgtccgggacatgccgattatattaag
aacatgatcaccggcacagcccagatggatggcgccattctcgttgtggccgccaccgat
ggcgccatgccccaaactcgcgagcatatgctgctagccaagcagatcggcattgatcac
atcgtggtgttcatcaacaaggtggacgccgccgatgaggagatggtcgacctggtggag
atggagatccgagagctgcttaccgagatgggctatgatggtgacaagatccctgtggta
aagggctcggcgctgtgcgccctcgaggacaagagtcccgagatcggcaaggaggcgatc
ctgaaactgctccaggaggtggatagcttcatccccacgcctgtgcgcgagctggacaag
cccttcctgctgcctgttgagaatgtgtattcgattcccggacgcggcaccgtcgtcact
ggtcgcctggagcgcggagtggtcaagaagggcatggagtgcgagttcgtgggctataac
aaggtgctgaagtcgacggtgacgggcgtggagatgttccaccagattctggaggaggcg
caagccggtgatcagctgggagctctggtgcgcggcgttaagcgagatgacatcaagcgc
ggcatggtcatgtgcaagccgggcagtgtgaaggcactcgatcagctggaggcccaggtg
tacatcctgtccaaggatgaaggcggtcgcacaaagcccttcatgtccttcatccaactg
cagatgttctcccgcacctgggactgtgccgtgcaggtgcagattcccgataaggagatg
gtcatgcccggcgaagacaccaagctcattctgcgcctcatccggccaatggtcctggag
cagggacaacgcttcacgctgcgtgacggaaacctgaccctgggcactggtgtcgtcacc
agcactctgcccccattgactgaatcgcagcgatccgagttgacggagggcaagaaggcg
cgcgagaagaaggtggcggctaagaagtag

DBGET integrated database retrieval system