KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6705
Entry
Dmel_CG6705       CDS       T00030                                 

Gene name
tsl
Definition
(RefSeq) torso-like, isoform C
  KO
K12377  torso-like protein
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG6705 (tsl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dme02000]
    Dmel_CG6705 (tsl)
Transporters [BR:dme02000]
 Other transporters
  Pores ion channels [TC:1]
   Dmel_CG6705 (tsl)
SSDB
Motif
Pfam: MACPF
Other DBs
NCBI-GeneID: 42564
NCBI-ProteinID: NP_001262810
FlyBase: FBgn0003867
UniProt: P40689 A4V379
LinkDB
Position
3R
AA seq 353 aa
MRSWPGLFWLLTLALLADGGRRESQLRIGKAINIFLRYGYLGISMRVIPLNDNSEPDRWV
FKEPTKNIYRNLSGLAESHEDTTPGIFHGDFHMEFCENRRQLFQAYFRDFSIERMDKPWE
AFTGGWFPDNAAKKLGINTSFIQGDYSYVLVRVVRFRETGRLNAEIPVHQPLEPDVRSRM
DQLQIGNITSAVRFMEDVGTHYVNSYTTGNSLYQVFVYSRKNYSMIKERIKSKGLNGLSK
LDLYNYFAPWFAAHLGQIRSASANATVERWARRKLQYEYYVVKYVTLLKLHGNSTLLRSL
DSLLGNDAILQLDLKSLKPIFREEPEKESWYHEVLDNNVKLWELNMPQSHPTR
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgcggtcgtggcctggccttttctggctgctgaccctggcgctcctggcggatggaggt
cgtcgcgagtcccagctccggatcggcaaggccatcaatatattcctgcgctatggctac
ctgggaatctccatgcgtgtgataccgctcaatgacaactcggagccggatcgctgggtg
tttaaggagcccaccaaaaacatctataggaatctgagtggcctggcggagagtcatgaa
gacaccacgcccggaatctttcatggagactttcacatggagttctgcgagaatcggagg
caactgttccaggcctacttccgtgacttttccattgagcgaatggacaaaccgtgggag
gcatttactggcggatggtttccggataatgcggccaagaagctgggcatcaatacatct
ttcatccaaggcgattactcgtatgttttggtgagggtggtgcgcttcagggaaacgggg
cgtcttaacgctgagattccggtgcaccaacccttggagccggatgtgcgatcgagaatg
gatcaactgcaaatcggaaatataacttccgcagtgcgatttatggaagatgtgggcacc
cactacgtaaactcatacaccaccggcaattcgctgtatcaggtgtttgtgtacagcagg
aagaactacagcatgatcaaggagcgaatcaagagtaaaggtctgaacggactgtccaag
ttggatctttacaactactttgcgccctggtttgccgcccatctgggccagattcgatcg
gctagtgccaatgctacagtggaaagatgggcgagaaggaagctgcagtacgagtactat
gtggtcaagtatgtgaccctgctgaaactgcacggtaatagtactctactgcgatccctg
gactcgctgctcggcaacgatgccatactgcagttggacctcaagtcgctgaagcccatc
ttccgggaggagccggaaaaggagagctggtaccacgaggttctcgacaacaatgtgaag
ctctgggagcttaacatgccgcagagtcatcccacccgatag

DBGET integrated database retrieval system