KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6781Help
Entry
Dmel_CG6781       CDS       T00030                                 

Gene name
se
Definition
(RefSeq) sepia
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00480  Glutathione metabolism
dme00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Dmel_CG6781 (se)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dmel_CG6781 (se)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     Dmel_CG6781 (se)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin GST_N_4
Motif
Other DBs
NCBI-GeneID: 38973
NCBI-ProteinID: NP_648235
FlyBase: FBgn0086348
UniProt: Q9VSL3
LinkDB All DBs
Position
3L
AA seq 243 aa AA seqDB search
MSNGRHLAKGSPMPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEW
LLEKNPQGKVPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIER
FRAVLGAFFKASDGGDLEPFWSGLDIYERELARRGTEFFGGEQTGILDYMIWPWCERLEL
LKLQRGEDYNYDQSRFPQLTLWLERMKRDPAVMAFYMEAEVQAEFLRTRSLGRPNYNLLV
KDA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacggcaggcatttggcaaaaggctcacccatgccggatgttcccgaagatggt
atccttcgcctgtactcgatgcgcttctgcccatttgcccaacgggtgcatctggtcctg
gacgccaagcagatcccgtatcacagcatctacattaatctcacagacaagccggagtgg
ctgctggagaagaatccacagggcaaggtgccggctctagaaatcgtgcgagaacctgga
ccacctgtgctcacagagtcgctactgatttgtgaatatctggacgagcagtatccattg
cgaccactctatccacgtgatccgctgaagaaagtgcaggacaagttactaatcgagcga
tttagagcggtgttaggtgccttcttcaaggcatccgatggcggtgatctggagcccttc
tggagcggcctggacatctacgaaagggagctggctcgacgtggtacggaattctttggt
ggcgagcagacgggcattctggactatatgatttggccctggtgtgagcgcctcgagctc
cttaagttgcagcgtggagaggattataactacgatcagagtcgcttcccccagctgacc
ctttggctggaacgcatgaaacgagatccggctgtgatggccttctacatggaggccgag
gttcaggcggagttcctgcgtacacggagcctgggtcgacccaattacaatctgctggtc
aaggatgcctga

DBGET integrated database retrieval system