KEGG   Drosophila melanogaster (fruit fly): Dmel_CG6856
Entry
Dmel_CG6856       CDS       T00030                                 

Gene name
Dysb
Definition
(RefSeq) dysbindin, isoform B
  KO
K20189  dysbindin
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG6856 (Dysb)
Membrane trafficking [BR:dme04131]
 Endosome - Lysosome transport
  Others
   BLOC-1 complex
    Dmel_CG6856 (Dysb)
SSDB
Motif
Pfam: BLOC1_2 Lbh LMBR1
Other DBs
NCBI-GeneID: 40052
NCBI-ProteinID: NP_001262023
FlyBase: FBgn0036819
UniProt: Q9VVT5 M9PI95
LinkDB
Position
3L
AA seq 288 aa
MFGNLKKKLSSAIQEGLVISENLQQQYRQRVSSGNSGSSQASGITTPISPLGLNESLSSS
RSSSLSLSAPFQLTDGVPSHLNVAAGCSLLAKYEDDWQQIHGANEKNAEKAAQIANQISG
IQDQASHQHRIMSELNSSLAGIPTLIAQLQNSSQVLNSLEEMGKQLEIELEKLEDLREEC
ELQEFILEQQFQLSRHKQKKLNELEQYRQQIAQKHQSKIKDQEQTLLKLQRERQAVFDDA
FREDMEEYKQRGQLTKIQTTSNKLALEEVVLEANEVETKDALEQFLNG
NT seq 867 nt   +upstreamnt  +downstreamnt
atgttcgggaacctgaaaaagaagcttagcagtgcgatccaggagggcctggtgatctcg
gagaatctgcaacagcaatatcgccagcgtgtcagttccggaaactcggggagtagccaa
gccagtgggattacgacccccatttcgccactgggccttaacgaaagtctgtcgtccagc
aggagcagtagcctctcccttagtgctcccttccagctaaccgatggagtgcccagtcac
ctaaatgtggcagctggttgcagtttgcttgccaaatacgaggatgattggcagcagatt
catggcgccaacgaaaagaacgcggagaaggctgcgcagattgctaaccaaatctccggc
atccaagaccaggccagccatcagcacaggatcatgagtgagctgaacagtagtctggcg
ggaattcccacgttgatagcccaactgcaaaacagctcacaggttcttaattccctggag
gaaatgggtaagcagttggagattgagctcgagaagctggaggatctgcgcgaggagtgt
gagctccaagagttcatccttgagcagcagtttcagctctcccggcacaagcaaaagaaa
ctgaacgaactggagcagtatcgccagcaaatagcccagaaacaccaatccaaaatcaag
gatcaggagcagaccctcctgaagctgcagagggaacgacaggctgtcttcgacgacgcc
ttccgggaggatatggaggagtacaaacagcgcggccagctgacaaaaattcaaaccacc
agcaacaagttggctctggaggaagtcgtccttgaagccaacgaagtggagacaaaggat
gctctggaacaatttctaaatggctaa

DBGET integrated database retrieval system