KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7023Help
Entry
Dmel_CG7023       CDS       T00030                                 

Gene name
Usp12-46
Definition
(RefSeq) Ubiquitin-specific protease 12/46
  KO
K11842  ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
dme  Drosophila melanogaster (fruit fly)
Brite
KEGG Orthology (KO) [BR:dme00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dme01002]
    Dmel_CG7023 (Usp12-46)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG7023 (Usp12-46)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     Dmel_CG7023 (Usp12-46)
Peptidases and inhibitors [BR:dme01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   Dmel_CG7023 (Usp12-46)
Ubiquitin system [BR:dme04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    Dmel_CG7023 (Usp12-46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 ATF7IP_BD AF-4 Macoilin DUF2852
Motif
Other DBs
NCBI-GeneID: 42702
NCBI-ProteinID: NP_651099
FlyBase: FBgn0039025
UniProt: Q9VCT9
LinkDB All DBs
Position
3R
AA seq 424 aa AA seqDB search
MGANVSQLEREIGSDLFPPNEHYFGLVNFGNTCYSNSVLQALYFCKPFREKVLEYKAKNK
RPKETLLSCLADLFYSIATQKKKVGSIAPKKFITRLRKEKEEFDNYMQQDAHEFLNFLIN
HINEIILAERNAGPSNGNPKATNQGGSTSAMASSIASKSSSTSNSNSNSNSTTNSNGNSS
NSTGSLNANTSVLDASGSLTATTTPIISGNGTGTNGANSEPTWVHEIFQGILTSETRCLN
CETVSSKDENFFDLQVDVDQNTSITHCLRCFSNTETLCSDNKFKCDNCCSYQEAQKRMRV
KKLPMILALHLKRFKYMEQFNRHIKVSHRVVFPLELRLFNTSDDAVNPDRLYDLTAVVIH
CGSGPNRGHYISIVKSHGLWLLFDDDMVDKIEASTIEDFYGLTSDIHKSSETGYILFYQS
RDCA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccaatgtgtcgcagctggagcgggagattggctccgatctgttcccaccgaat
gagcactacttcggtctggtgaactttgggaacacctgctacagcaactcggtgctgcag
gccctctacttttgcaagccattccgcgagaaggtccttgagtacaaggccaagaacaag
aggcccaaggagacgctgctgtcgtgtctggcggatctgttctacagcattgccacgcag
aagaagaaggtgggctcgattgcgcccaaaaagttcataaccaggctgcgaaaggagaag
gaggagttcgataactatatgcagcaggatgcccacgagttcctcaactttctgatcaat
cacatcaatgagatcatactggccgaacggaatgcagggcccagcaatgggaatcccaag
gccaccaatcaaggcggaagcacaagtgccatggccagcagcatagctagcaagtccagc
tcaacgtccaactcgaattccaactccaattcgacaacaaactcaaatggcaacagtagc
aattcgacgggatcactgaatgccaacacaagtgtgctggatgccagtggcagtcttacg
gccaccacaacacctataatctcaggaaacggaacgggaaccaatggggccaactcggag
cccacctgggtgcacgagatctttcagggcatacttacgtccgagaccaggtgcctcaac
tgcgagacggtgagcagcaaggacgagaatttcttcgatctccaggtggacgtggaccag
aacacctcgattacgcactgcctgcggtgcttcagcaacacggagaccctgtgctcggac
aacaagttcaagtgcgacaattgctgcagttatcaggaggcgcagaagaggatgcgtgta
aagaagttgcccatgatcctggccctgcatctcaagcgcttcaagtacatggagcagttt
aataggcacatcaaggtctcgcatcgcgttgtgtttccactggaactgaggctctttaac
acctccgatgatgcagtgaatcctgatcgtctctacgatctgaccgctgtggttatccac
tgcggttccggaccaaatcgtggccattatatatccattgtgaagagtcacggactgtgg
ctactattcgacgatgatatggtggacaaaatcgaggcttccacaatcgaggacttctat
ggtctgacctcggacatacacaagtcttcggagaccggctacatactgttctatcagtcg
cgggactgcgcctaa

DBGET integrated database retrieval system