KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7392
Entry
Dmel_CG7392       CDS       T00030                                 

Gene name
Cka
Definition
(RefSeq) connector of kinase to AP-1, isoform E
  KO
K17608  striatin 1/3/4
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG7392 (Cka)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dme01009]
    Dmel_CG7392 (Cka)
Protein phosphatases and associated proteins [BR:dme01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Other PP2-interacting proteins
     Dmel_CG7392 (Cka)
SSDB
Motif
Pfam: Striatin WD40 Nup160
Other DBs
NCBI-GeneID: 34096
NCBI-ProteinID: NP_001245936
FlyBase: FBgn0044323
UniProt: D3DML3
LinkDB
Position
2L
AA seq 749 aa
MGTNSGATAGINNKPVGGATGAGVLVGGGVGGANSSIGGVLSNSLGGGGSGGLSISGLNA
GGQNANVGGMGNVGGDDGGNGMVGGGVNNQQATTPQYTIPGILHFIQHEWSRFELERSQW
DVDRAELQARIAMLLGERKCLESLKSDLTRRIKMLEYALRQERAKFYRLKYGTDPPQLNE
FKPSNEDAGLAGEVATDSEVPYSSVSNTTWRQGRQMLRQYLAEIGYTDNIIDVRSNRVRS
ILGLNNNAEHDGSGGGLGGGLGGGTGGENLSPNINGNESNKRASETEGRHTPAKKVQQSI
DEIIVDTEAAVMANFEFLGATEMSDDDEISDDLEMVATDNDDTDVKLAKRAKSGKDMLTE
DLEADVGEQLLNDMNLMTEEVDGSLGLGELAQLTVNNESDGAYDANSKDGTGGSAGGAGY
RKTWNAKYTLRSHFDGVRSLIFHPEEPVLITASEDHTLKLWNLQKTVQAKKSASLDVEPL
YTFRAHTGPVLCLGMSSSGETCYSGGLDGNIECWQLPSPNIDPYDCYDPNVHSGTLEGHT
DAVWGLTTMQSNIVSCSADGTVKLWSPYNKEPLLRTYTASEAEGVPSSVDFVRNEVDHIV
VAYNSAHCIVYDTETGKQVVRLEAAQEMSGNTGKFINKVVSHPTLPITITAHEDRHIRFW
DNTSGTLVHSMVAHLEPVTSLAVDAHGLYLLSGSHDCSIRLWNLDNKTCVQEITAHRKKF
DESIFDVAFHATKPYIASAGADGLAKVFV
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgggcaccaattcgggagccaccgctggcataaacaacaagccggttggcggtgcaaca
ggagccggcgtccttgtaggcggcggtgtgggcggtgccaattcctcgatcggcggtgtc
ctgtcgaacagcctgggcggtggcggcagcggcggtctgagcatcagcggcctcaacgct
ggtggacagaacgccaatgtgggcggaatgggcaacgttggcggcgacgacggcggaaac
gggatggtgggcggcggtgtaaataaccagcaggccacaacgccccaatacacaataccg
ggcatcttgcacttcatccagcacgagtggtcgcgcttcgagctggagcgatcacagtgg
gacgtggacagggccgaattgcaggctcgcattgctatgctgcttggagagcgcaagtgc
ttggaaagcctcaaatcggatttgacgcgccgcatcaagatgctggagtacgcactgcgc
caggagcgtgcgaaattctatcgtttaaaatacggcaccgatccgccgcagctcaatgag
ttcaagccatcgaacgaggatgccggactggccggtgaggtggccactgactcggaggtg
ccctacagcagtgtctcgaacactacgtggcggcaggggcgtcagatgctgcgacagtat
ctggccgagattggctacacagacaacatcatcgatgtgcgttcaaatcgggtgcgttcg
atccttggcctaaacaataatgccgagcacgacggcagcggcggaggactgggtggtgga
cttggcggcggcaccggcggcgagaaccttagcccaaacatcaatggaaacgagagcaac
aaacgcgcatcggagacggaaggccgtcatactcccgctaaaaaagtgcaacaatcgatc
gatgaaataatcgtggacaccgaggcagctgtgatggcgaactttgagttcctgggcgcc
accgagatgtccgacgacgacgagatatctgacgatctggaaatggtggccaccgacaat
gacgacacagacgtaaagctggccaagcgcgccaagtctggcaaggatatgctcaccgag
gatctagaggccgatgtgggagagcagctattgaacgatatgaatctcatgactgaagag
gtggacggctcgttgggactgggtgagcttgcccagctgacggtgaataacgaatctgat
ggcgcctacgatgcgaactccaaggatggaactggcggcagtgccggcggtgctggttac
cgcaaaacctggaacgccaagtacacgcttcgctcgcactttgacggagtacgatcactt
atctttcacccagaggagccggtgctgatcacggcttccgaggatcatacgcttaagctg
tggaaccttcagaagacggtgcaggccaaaaagtcggccagcttggatgtggaaccgctg
tatacgttcagggcccatacgggtccagttctgtgcctgggcatgtcgtccagcggcgag
acatgctattcgggcgggctggacggtaacattgaatgctggcaattgccgtcgccgaat
atcgatccgtacgattgctatgatccgaacgtgcattccggcacgctcgaggggcatacg
gatgccgtgtggggccttaccaccatgcaaagcaacattgtgtcatgctcagcggatgga
acggttaagctgtggtcgccatacaataaggaaccgctgctgcgcacatacacagcctcc
gaggcagagggtgtaccctcatccgttgactttgttcgcaatgaggttgaccatatcgtg
gtggcctacaacagtgcccactgcatcgtgtacgatacggagacgggcaagcaggtggtg
cgtctggaggcggcgcaggagatgtctggcaacacggggaagttcattaacaaggtggtg
tcacacccaacgctacccattacgataaccgcgcacgaggatcgtcacatccgcttctgg
gacaacacatccggcacgctggtacactccatggtggcgcatttagagccggtcacctcg
ctggccgtcgatgctcatggcctgtatttgctatccggctcgcacgactgctcgatacgg
ctgtggaacctggacaataagacgtgcgtgcaggagatcacagcgcatcgcaagaagttt
gacgagagcatattcgatgtggccttccatgccacaaagccgtacattgctagtgccggg
gccgatggcctcgccaaggtctttgtctaa

DBGET integrated database retrieval system