KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7471Help
Entry
Dmel_CG7471       CDS       T00030                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04213  Longevity regulating pathway - multiple species
dme04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    Dmel_CG7471 (HDAC1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dmel_CG7471 (HDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG7471 (HDAC1)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Dmel_CG7471 (HDAC1)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     Dmel_CG7471 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     Dmel_CG7471 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    Dmel_CG7471 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    Dmel_CG7471 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 38565
NCBI-ProteinID: NP_647918
FlyBase: FBgn0015805
UniProt: Q94517
LinkDB All DBs
Position
3L
AA seq 521 aa AA seqDB search
MQSHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAD
EMTKFHSDEYVRFLRSIRPDNMSEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAAV
KLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGDG
VEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDDAYESIFV
PIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGKCVEFVKKYNLPFLMVGGGG
YTIRNVSRCWTYETSVALAVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTSEYLEKI
KNRLFENLRMLPHAPGVQIQAIPEDAINDESDDEDKVDKDDRLPQSDKDKRIVPENEYSD
SEDEGEGGRRDNRSYKGQRKRPRLDKDTNSNKASSETSSEIKDEKEKGDGADGEESTASN
TNSNNNSNNKSDNDAGATANAGSGSGSGSGAGAKGAKENNI
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctcacagcaaaaagcgcgtttgttactactacgacagcgacattggcaactac
tactatggccagggtcatcccatgaagccccatcgcatacgcatgacccacaacctgctg
ctcaactatgggctctatcgaaaaatggaaatataccgtccccataaagccactgccgat
gagatgaccaagttccactcggacgagtacgtccggttcttgcgatccattcggccggac
aacatgtcggagtacaacaagcagatgcagcgtttcaatgtcggcgaagattgtcccgtc
ttcgatggactatacgagttttgccaactctccgccggaggatccgtagctgcggccgta
aaactgaataagcaagcctcggagatctgcatcaattggggcggtgggctgcatcacgcc
aaaaaatcggaagcctcgggcttctgctacgtcaacgacattgttctgggaattctggaa
ctgcttaaataccatcagcgtgttctctacatagatatagacgtccatcacggcgatggc
gtggaggaggcgttctataccaccgatcgtgtgatgactgtcagcttccacaagtacgga
gagtatttcccgggcactggcgatctgcgagacattggcgccggcaagggaaagtactat
gcggtgaatatacccctgcgtgatggcatggatgatgatgcgtacgagagcatatttgtg
cccattatcagcaaggtgatggaaacattccagccggcagccgtggtgttgcagtgtggc
gccgattcgctgactggcgatcggttaggctgcttcaatctcaccgtcaagggtcacggc
aagtgcgtggagttcgtgaagaaatataacctgccattcctgatggtcggcggtggtggt
tataccattcgtaatgtatcccgctgctggacctatgagacctccgttgcactggccgtg
gagatagccaacgaactgccctacaacgattacttcgagtactttgggcccgattttaag
ctgcacattagtcccagcaatatgacgaatcagaatacatccgagtacctggagaagatc
aagaaccgtctgttcgagaacctgcgcatgctgcctcacgctccgggcgttcaaatccaa
gcgattcccgaggatgccatcaacgatgagtccgacgacgaggacaaggtcgacaaggat
gatcgcctgccgcagagcgacaaggacaagcgcattgtgcccgagaacgagtactccgat
tcggaggatgagggcgaaggcggtcgcagggataaccgttcgtacaagggtcagcggaag
cggccgcgtctcgacaaggacaccaacagcaacaaggcatcctcagagacgtccagcgag
atcaaggacgaaaaggaaaagggcgacggagctgatggcgaggaatcgacggcgtctaat
accaatagcaacaacaacagtaacaacaagagcgataatgatgccggagcgacagctaat
gccggatccggttcgggatcaggttccggtgccggggccaagggcgccaaggagaacaac
atttga

DBGET integrated database retrieval system