KEGG   Drosophila melanogaster (fruit fly): Dmel_CG7864Help
Entry
Dmel_CG7864       CDS       T00030                                 

Gene name
Pex10
Definition
(RefSeq) peroxin 10, isoform B
  KO
K13346  peroxin-10
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dmel_CG7864 (Pex10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dme04121]
    Dmel_CG7864 (Pex10)
Ubiquitin system [BR:dme04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Peripheral membrane proteins
    Dmel_CG7864 (Pex10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pex2_Pex12 zf-C3HC4_3 zf-RING_2 zf-C3HC4_2 Prok-RING_4 zf-C3HC4 zf-RING_5 zf-rbx1 zf-RING_UBOX zf-C3HC4_4 zf-ANAPC11 zf-RING_4 Rtf2 TPR_21 Zn_ribbon_17
Motif
Other DBs
NCBI-GeneID: 38182
NCBI-ProteinID: NP_001261265
FlyBase: FBgn0035233
UniProt: Q9W0D7
LinkDB All DBs
Position
3L
AA seq 299 aa AA seqDB search
MDFRNARARQPEIVRSVQKDARYTNELAEDLSDVLRLTGPRNWIKYNQMCRLLAELSYHG
FASANNLQTLGEEYTGIIQVDGNYKQIPSRLLQLIAIVLEFGGDSLFQRLMQKLDTYVAN
NDEIRTEIKPQLKKIIQRLRQSPSYVKALHKSLFYLDASKYQLSKRTTGINYVLIRHWLQ
PEFSLYGYKILGVITFLQVSVSLAISGWDAWREHKRQQLESIKQAGKNFLQRSSSTKDVD
PNTPQCILCLEPRSDSSLTPCGHIFCWSCLLEWLEERDECPLCRESLKKSQVILLQNYA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggactttcggaacgcccgcgcccggcagccggagatcgtgagatccgtgcagaaggat
gcacggtacaccaacgagctggccgaagacttgtccgatgtcttgcgcctcaccggtcca
cggaactggataaagtacaaccagatgtgccgacttctggcggagctcagttaccacgga
ttcgcctcggccaataaccttcagaccctcggcgaagagtacacggggataatacaggtg
gacgggaactataagcagattcccagcagattgttacaactgattgccattgtcctggag
tttggtggcgactccctgttccaacgattgatgcaaaaacttgacacctacgtggccaac
aatgacgagattcgaaccgagatcaagccgcagctaaagaagattattcagaggctcagg
caatctcccagctacgtaaaggccctgcacaagtctctattctacttggacgccagcaag
taccagctgtccaagcgcaccacgggcatcaactacgtactaatccgtcactggctgcag
ccggaattctcgctgtacggctacaagatactgggcgtaatcactttcctgcaggtcagc
gtttccttggccattagtggatgggatgcctggagagagcacaagcgccagcagctagaa
tcaataaagcaggctggaaagaatttcctgcaaagatcttcgagtacaaaggacgtagat
ccaaacaccccacagtgcatcctttgcctggagccacgttctgacagcagtttgactcca
tgcggccacatcttttgctggagctgcctgctcgagtggctggaggagcgggatgagtgc
cccttgtgccgggagtcgctgaaaaagtcccaagtgatattactgcaaaactatgcctaa

DBGET integrated database retrieval system