KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8238
Entry
Dmel_CG8238       CDS       T00030                                 

Gene name
Buffy
Definition
(RefSeq) buffy
  KO
K20017  Bcl-2 family protein
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04214  Apoptosis - fly
dme04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    Dmel_CG8238 (Buffy)
   04215 Apoptosis - multiple species
    Dmel_CG8238 (Buffy)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 36251
NCBI-ProteinID: NP_523702
FlyBase: FBgn0040491
UniProt: Q8T8Y5
LinkDB
Position
2R
AA seq 299 aa
MPGTSYPTNNDNFSNGFPMATTQSERLLQAQNRRKFSFPATLHSASLLEVGGGPKETTRR
RLSNVSDAVTRKLSYTIGWKAAQIPAQDIISQGRCLCGHYIKRRLRRSGLFNKKLGLQRI
RSILGSTSMGIVRDVFPAVQVLGDELERMHPRIYNGVARQICRNPGGEFHTPDAVSLLLG
AVGRELFRVEITWSKVISLFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINE
NGGWSGINTHVLPTTNSLNPLEWTTLVIGVVFGLILVFMILRFIFNLIVPKIYQRFTNS
NT seq 900 nt   +upstreamnt  +downstreamnt
atgcccggcacctcgtatcccacgaataacgataatttcagcaacggatttccgatggcc
accacacaaagtgagcgcctcttgcaggcccagaatcgaagaaagttcagttttccagcc
acactacattccgcatcactactggaggttggtggtggtcccaaggagaccacgaggcgt
aggttgagtaatgtcagcgatgccgtcaccaggaaactctcctacacgattggctggaag
gcggcacagattccagcgcaggatatcatttctcagggtcgttgcctgtgcggtcattat
atcaagagacgcctcagaagatctggtttgttcaacaaaaagctgggactgcagcgcata
cgtagcatactgggctccacctccatgggcattgtgcgcgatgtgtttccagcggtccaa
gtgctgggcgatgaactggagcgcatgcatccccggatatacaacggagtagctcgtcag
atttgccggaatccgggtggtgagttccatactccggatgctgtgagcttgcttttggga
gccgttggtcgcgagctcttccgggtggagattacgtggagcaaggtgatctctctgttc
gccatcgccggtgggctgtccgttgattgtgtacgccaaggacatccggaatacttgccc
aagttgatggagagcgtttccgaggtgatcgaagatgagctggttccgtggattaacgag
aatggtggttggagtggcatcaacacacacgttttacccactaccaacagcctgaatcct
ttagagtggaccactttggttataggcgtagtttttggcctaattctagtttttatgatt
ctgcgatttatatttaacttgattgtaccaaaaatataccaacgatttacgaattcctaa

DBGET integrated database retrieval system