KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8360
Entry
Dmel_CG8360       CDS       T00030                                 
Symbol
CG8360
Name
(RefSeq) uncharacterized protein, isoform C
  KO
K01489  cytidine deaminase [EC:3.5.4.5]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme00240  Pyrimidine metabolism
dme00983  Drug metabolism - other enzymes
dme01100  Metabolic pathways
dme01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:dme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Dmel_CG8360 (CG8360)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    Dmel_CG8360 (CG8360)
Enzymes [BR:dme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.5  cytidine deaminase
     Dmel_CG8360 (CG8360)
SSDB
Motif
Pfam: dCMP_cyt_deam_1 dCMP_cyt_deam_2
Other DBs
NCBI-GeneID: 34122
NCBI-ProteinID: NP_001260232
FlyBase: FBgn0032001
UniProt: Q9VLR3
LinkDB
Position
2L
AA seq 158 aa
MTQVFINGARDDLNVREFQSLDPSIQEIILAATEARKQAYCPYSNFAVGAALRTSDGTIY
SGCNIENGAYATCICAERTAAVKAISEGKRDFVACAVVAQQDNGFTTPCGVCRQFLSEFV
NGKDIPLYAAKPTNLPLRVLCTSVLQLLPNGFSFANGK
NT seq 477 nt   +upstreamnt  +downstreamnt
atgacacaggtgtttatcaatggtgccagagacgatctcaatgtacgggaattccagagc
ctggatccttcgattcaagagatcatcctggcagccacggaagccagaaaacaggcttat
tgtccgtacagtaactttgccgtaggagccgccctgaggaccagcgatggcaccatatac
tccggttgcaacatcgaaaacggggcgtatgccacctgcatttgtgcagagcgcactgca
gccgtcaaggccatcagtgaaggcaaacgcgactttgtggcttgtgcagtggtggcccag
caggataatggcttcaccacgccttgtggcgtctgccggcagttcctctcggagttcgtc
aacggcaaggacatccccctgtacgccgccaagccgaccaatcttccattgagggtgctc
tgcaccagcgttctccaactgctgcccaacggctttagcttcgccaacggaaaatag

DBGET integrated database retrieval system