KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8583
Entry
Dmel_CG8583       CDS       T00030                                 

Gene name
Sec63
Definition
(RefSeq) secretory 63
  KO
K09540  translocation protein SEC63
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme03060  Protein export
dme04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dme00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Dmel_CG8583 (Sec63)
   04141 Protein processing in endoplasmic reticulum
    Dmel_CG8583 (Sec63)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dme03110]
    Dmel_CG8583 (Sec63)
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dme02044]
    Dmel_CG8583 (Sec63)
Chaperones and folding catalysts [BR:dme03110]
 Heat shock proteins
  HSP40 / DNAJ
   Dmel_CG8583 (Sec63)
Secretion system [BR:dme02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   Dmel_CG8583 (Sec63)
SSDB
Motif
Pfam: Sec63 DnaJ Cwf_Cwc_15
Other DBs
NCBI-GeneID: 38819
NCBI-ProteinID: NP_648111
FlyBase: FBgn0035771
UniProt: Q9VS57
LinkDB
Position
3L
AA seq 753 aa
MAGQKFQYDESGGTFYYFVLSFLALILIPTTIYYWPRKKKQDNSKLKEECQCADCQKKKT
ILANAEPYRALTSWTIKLTIVLGWALLLFLTYRVSQFDYEMASFDPFEILNVPPTSSQAE
IKKAYYRLSKVLHPDKETGDEKSFMMLSKAYQALTDDVAKENYEKYGNPDGPGAMSFGIA
LPSWIVEKENSVWVLGLYGLVFMVAMPSAVGVWWYRSIRFSGDKVLLDTTQMYFYFIHKT
PHMLLKRALMVLAASLEFDKRHNSQVQERQSDNDEVPALIRQLPNLNEKCKEHPLCRMYS
IKARAILHAHLSRMPLNPETLERDRQFVVKKCPYLVQEMVSCVHQLVMMAYARRVPRLPS
IETIENCMKMSPMIIQGLWEFKSPLLQLPHLTEDHLYFMNKKRHVKNLQQFAQLKPEESR
QLLKNLSDFEYENTMKVLGKMPLIDFSIRCEVIDDENTNVVTAGAIVTVTVTLERKDMKT
LFGDTKAPEKQGIKDETNEEAAGDEDEAAAAAPVKKASAWAKPRKGGKGKGGKKPAQNQK
NQKKVPAKAATTATITASEDQAAAGNSDAESEAGNADGSDVESAAGSGSEDEEKGKNNSS
LDDDDDEEWERLQAKLNKRERLEGKSRLSHTVHCPYFPEEKQEYWWTYICDRKSRTLLTA
PYHVTNLVEKEEIQLKFTAPRWPGVYTFTVCLRSDSYLGMDQQQELKLDVQKAPAPPTDH
PQWDLSESEPEHTDQQENLSDYTTDTSDEEDGE
NT seq 2262 nt   +upstreamnt  +downstreamnt
atggcgggtcaaaagtttcagtatgatgagagcggcggaacgttctactactttgtgtta
tcgttcttggcgctaatattgataccgaccaccatttactattggccacgtaaaaagaaa
caagataacagcaaacttaaagaggaatgtcagtgcgccgactgccagaaaaagaagacc
atcttggccaatgccgagccgtacagagctctcacgtcatggaccatcaagctgaccata
gtgctggggtgggccctactgctcttcctcacgtaccgcgtctcgcagttcgactacgag
atggccagcttcgatcccttcgagatcctgaatgtgccgccgacgtcgtcgcaggccgag
atcaagaaggcctactaccggctgtccaaggtgctccatcccgacaaggagacgggtgac
gagaagtccttcatgatgctgagcaaagcgtaccaggcgctgaccgacgatgtggcaaag
gagaactacgagaagtatggtaatccggatggaccgggtgccatgtcctttggcatcgcc
ctgccctcgtggattgtggagaaggagaatagcgtttgggttttgggtctgtacggcctg
gtcttcatggtggccatgccctcggcagtgggtgtttggtggtaccgctccatccgcttc
agtggcgacaaagtgctgctcgataccactcagatgtacttttacttcatccacaagaca
ccgcacatgctgctcaagcgggcacttatggttctggcagccagtttggagtttgacaag
cgacacaactcgcaggtccaggagcggcagtcggacaatgacgaggtgccggcgctgatt
agacagctgcccaatctgaatgagaagtgcaaggagcatccgctgtgccgcatgtactcc
atcaaggctcgcgccatcctgcatgcccatctcagtcgcatgcccctcaatccggaaact
ctggagcgcgatcgccagtttgtggtgaagaagtgcccgtatttggtgcaagaaatggtc
tcctgcgttcaccagctggtcatgatggcctatgcccgacgtgtgccccgcctgcccagc
atcgaaacgattgagaactgcatgaaaatgtcgccgatgattatccaaggcctgtgggag
ttcaaatcgccactgctgcagctgccccatctcaccgaggaccatctgtactttatgaac
aagaagaggcacgtcaagaacctgcagcaattcgcccagctcaagccggaggagagccgt
cagcttctgaagaacctatctgactttgagtacgagaacacgatgaaagtgctgggcaag
atgccgctgattgacttctccattcgctgcgaggttatcgacgatgagaacaccaatgtg
gtgaccgccggggccatagttacggtcacggttacgctggagcgcaaggacatgaagacg
ctattcggtgacacaaaggcgcctgagaagcagggcatcaaggatgagaccaatgaggag
gctgccggtgatgaggatgaggctgctgccgctgcgccggtcaagaaggcttctgcctgg
gccaagccacgtaagggtggcaagggaaagggtggtaagaaaccagcccagaaccaaaag
aaccagaagaaggtgccggccaaggctgcgacaacagctacgatcacggcatccgaggat
caagcggcggcgggtaactccgatgccgaatcggaggctggaaatgcggatggcagcgat
gtggaatcggctgccggcagtggcagcgaggatgaggagaagggcaagaacaactcctcg
ctggacgacgacgatgacgaggagtgggagcgactgcaagctaagcttaacaagagggag
cgtctcgagggcaagtctcggctgtcgcacaccgtccactgcccctacttccccgaggag
aagcaggagtactggtggacctacatatgcgatcgcaagtcgcgcaccctgctcacagcg
ccctatcatgtgaccaatctggtcgagaaggaggagatccagctgaagtttaccgcgccg
cgctggccgggcgtctacacgttcaccgtttgcctgagatcggactcgtatttgggtatg
gatcagcagcaggagctgaagttggatgtacagaaggctcccgcaccaccgacggatcat
cctcagtgggatctgagcgaatcggaaccggagcacaccgatcagcaggagaacctgagc
gactatacaacagatacgtccgatgaggaggacggcgaataa

DBGET integrated database retrieval system