KEGG   Drosophila melanogaster (fruit fly): Dmel_CG8905Help
Entry
Dmel_CG8905       CDS       T00030                                 

Gene name
Sod2
Definition
(RefSeq) superoxide dismutase 2 (Mn), isoform B
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
dme04068  FoxO signaling pathway
dme04146  Peroxisome
dme04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG8905 (Sod2)
   04068 FoxO signaling pathway
    Dmel_CG8905 (Sod2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Dmel_CG8905 (Sod2)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dmel_CG8905 (Sod2)
Enzymes [BR:dme01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Dmel_CG8905 (Sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_N Sod_Fe_C
Motif
Other DBs
NCBI-GeneID: 36878
NCBI-ProteinID: NP_001286503
FlyBase: FBgn0010213
UniProt: Q00637 A0A0B4LGQ1
LinkDB All DBs
Position
2R
AA seq 217 aa AA seqDB search
MFVARKISQTASLAVRGKHTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLNAAEE
QLEEAKSKSDTTKLIQLAPALRFNGGGHINHTIFWQNLSPNKTQPSDDLKKAIESQWKSL
EEFKKELTTLTVAVQGSGWGWLGFNKKSGKLQLAALPNQDPLEASTGLIPLFGIDVWEHA
YYLQYKNVRPSYVEAIWDIANWDDISCRFQEAKKLGC
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtggcccgtaaaatttcgcaaactgcaagcctggcggtgcgtggcaagcacacc
ctaccgaagctgccctacgactatgccgccctggagcctatcatctgccgggagatcatg
gagctgcatcaccagaagcaccaccagacctacgtcaacaatctaaatgccgccgaggag
cagctggaggaggccaagtcgaagagcgacaccaccaagctgattcagctggctcctgcc
ctgcgtttcaatggcggtggccacatcaaccacaccatcttctggcagaacctctcgccc
aacaagacccagcccagcgatgatctgaagaaggccatcgagtcgcagtggaagagcctc
gaggagttcaaaaaggagctgaccacgctgaccgtggcggtccagggctccggctggggc
tggctgggcttcaacaagaagtcgggcaaactgcaactggccgccctgcccaaccaggat
cccctggaggcctccaccggcctgatcccgctcttcggcatcgatgtctgggagcacgcc
tactatctgcagtacaagaacgtgcgtccctcctacgtggaggccatctgggacatcgcc
aactgggatgacatctcgtgccgcttccaggaggccaagaagctcggttgctaa

DBGET integrated database retrieval system