KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9277Help
Entry
Dmel_CG9277       CDS       T00030                                 

Gene name
betaTub56D
Definition
(RefSeq) beta-Tubulin at 56D, isoform B
  KO
K07375  tubulin beta
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04145  Phagosome
Brite
KEGG Orthology (KO) [BR:dme00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    Dmel_CG9277 (betaTub56D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dme03036]
    Dmel_CG9277 (betaTub56D)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dme04812]
    Dmel_CG9277 (betaTub56D)
   04147 Exosome [BR:dme04147]
    Dmel_CG9277 (betaTub56D)
Chromosome and associated proteins [BR:dme03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     Dmel_CG9277 (betaTub56D)
Cytoskeleton proteins [BR:dme04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    Dmel_CG9277 (betaTub56D)
Exosome [BR:dme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dmel_CG9277 (betaTub56D)
  Exosomal proteins of colorectal cancer cells
   Dmel_CG9277 (betaTub56D)
  Exosomal proteins of bladder cancer cells
   Dmel_CG9277 (betaTub56D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_2 Tubulin_3
Motif
Other DBs
NCBI-GeneID: 37238
NCBI-ProteinID: NP_523795
FlyBase: FBgn0284243
UniProt: Q24560
LinkDB All DBs
Position
2R
AA seq 447 aa AA seqDB search
MREIVHIQAGQCGNQIGAKFWEIISDEHGIDATGAYHGDSDLQLERINVYYNEASGGKYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTYSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNIQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQEATADEDAEFEEEQEAEVDEN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagggaaatcgttcacatccaagctggtcagtgcggcaaccaaatcggcgccaagttc
tgggagatcatctccgatgagcatggcatcgatgccaccggcgcctaccacggtgacagc
gacctgcagctggagcgcatcaatgtgtactacaatgaggcgtccggtggcaagtacgtg
ccccgcgctgtccttgtcgatctggagcccggcaccatggactctgtgcgatcgggacct
ttcggccagatcttcaggcccgacaactttgtgttcggccagtcgggtgccggcaacaac
tgggccaagggtcattacacagagggtgctgagctggtggactcagtgctcgatgttgtc
cgcaaggaggccgaatcctgcgactgcctgcaaggcttccaactcacacactcccttggc
ggcggcactggctccggtatgggaaccctgctgatttccaagatccgcgaggagtacccc
gacaggatcatgaacacatactcggttgtgccgtcgcccaaggtgtcggacaccgttgtg
gagccctacaacgccaccctgtcggtgcaccagctggtcgagaacacggacgagacctac
tgcatcgacaacgaggctctctacgatatctgcttccgcaccctcaagctgacgacaccc
acatacggtgacctgaaccatcttgtctccctgaccatgtccggcgtaaccacctgcctc
cgattccccggccaactgaacgctgatctccgcaagctggccgtcaacatggtgcccttc
ccacgtcttcacttcttcatgcccggcttcgctcccctgacctcccgaggatcccagcag
taccgcgccctcaccgtgcccgagctgacccagcagatgttcgatgccaagaacatgatg
gccgcctgcgacccacgccacggacgctaccttaccgtcgccgccatcttccgtggacgc
atgtccatgaaggaggtcgacgagcagatgctgaacatccagaacaagaacagctcctac
ttcgtcgaatggatccccaacaacgtgaagaccgccgtgtgcgacatcccgccccgtggt
ctgaagatgtccgccaccttcatcggcaactccactgccatccaggagctgttcaagcgc
atctccgagcagttcaccgctatgttcaggcgcaaggctttcttgcattggtacaccggc
gagggcatggacgagatggagttcaccgaggccgagagcaacatgaacgatctggtgtcc
gagtaccagcagtaccaggaggccaccgccgacgaggacgccgagttcgaggaggagcag
gaggctgaggtcgacgagaactaa

DBGET integrated database retrieval system