KEGG   Drosophila melanogaster (fruit fly): Dmel_CG9553
Entry
Dmel_CG9553       CDS       T00030                                 

Gene name
chic
Definition
(RefSeq) chickadee, isoform E
  KO
K05759  profilin
Organism
dme  Drosophila melanogaster (fruit fly)
Pathway
dme04013  MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:dme00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    Dmel_CG9553 (chic)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dme04131]
    Dmel_CG9553 (chic)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dme04812]
    Dmel_CG9553 (chic)
   04147 Exosome [BR:dme04147]
    Dmel_CG9553 (chic)
Membrane trafficking [BR:dme04131]
 Others
  Actin-binding proteins
   Others
    Dmel_CG9553 (chic)
Cytoskeleton proteins [BR:dme04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     Dmel_CG9553 (chic)
Exosome [BR:dme04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dmel_CG9553 (chic)
SSDB
Motif
Pfam: Profilin Rhabdo_glycop
Other DBs
NCBI-GeneID: 33834
NCBI-ProteinID: NP_001245905
FlyBase: FBgn0000308
UniProt: P25843 M9NEU5
LinkDB
Position
2L
AA seq 126 aa
MSWQDYVDNQLLASQCVTKACIAGHDGNIWAQSSGFEVTKEELSKLISGFDQQDGLTSNG
VTLAGQRYIYLSGTDRVVRAKLGRSGVHCMKTTQAVIVSIYEDPVQPQQAASVVEKLGDY
LITCGY
NT seq 381 nt   +upstreamnt  +downstreamnt
atgagctggcaagattatgtggacaaccaactcctggcctcgcagtgcgtgaccaaggcg
tgcatcgccggccacgacggcaacatttgggcgcagtccagtggctttgaggtgacaaaa
gaggagctctccaaactgatcagcggctttgaccagcaggacggtctcaccagcaacggc
gtgacactcgccggccagcggtacatttacctttccggcacagaccgcgtggtgcgcgcc
aagctcggccggagcggagtgcactgcatgaagacaacacaagccgtgatcgtttccatc
tacgaggatcccgttcagccccagcaggccgcttccgtggtagagaaacttggagattat
ctgattacttgcgggtactag

DBGET integrated database retrieval system