KEGG   Desulfosporosinus meridiei: Desmer_0769Help
Entry
Desmer_0769       CDS       T02207                                 

Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase, phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00340  Histidine metabolism
dmi01100  Metabolic pathways
dmi01110  Biosynthesis of secondary metabolites
dmi01230  Biosynthesis of amino acids
Module
dmi_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:dmi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Desmer_0769
Enzymes [BR:dmi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     Desmer_0769
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     Desmer_0769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG DUF3239
Motif
Other DBs
NCBI-ProteinID: AFQ42801
UniProt: J7IVT9
LinkDB All DBs
Position
794114..794791
Genome map
AA seq 225 aa AA seqDB search
MDRNIIQALDLSTIRWDAQGLVPAIVQDVETKGVLMLAYMNEESLRRTLLERKACYYSRS
RQSLWLKGETSGHFQEIVDIKFDCDKDTLLLTVKQIGMACHENYFSCFHYDLTNEGFKEI
GEPEVRPELTLGRTLELLTEVIHSRNLERPEGAYTTYLFEKGIDKILKKVGEESAEVIIA
AKNSDPDEIRCEVSDLFYHVLVMLEERGVSVEEVSRELLKRRSKD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggatagaaatataattcaagctttagacttatcgacgatccgctgggatgctcagggc
cttgtgcctgcgattgttcaggatgtagagactaaaggagtcttaatgctggcatatatg
aatgaagagtccttacggcgaaccctgcttgagaggaaggcttgctattatagtagaagc
cgacaatccttgtggctgaaaggggaaacctctgggcattttcaggagatcgtcgacatt
aaatttgactgtgacaaggacacattactcttgactgtgaagcagataggtatggcttgc
catgaaaattacttttcgtgtttccactatgatttaactaacgaagggtttaaagagatc
ggggaaccggaggtaagacctgagctaacactgggcaggactctagaacttttaacggaa
gttattcactctaggaacttagaacgtcctgagggggcttataccacttatttgtttgaa
aagggaattgacaaaatcctcaaaaaggttggagaagaaagtgcagaagtgattattgct
gctaaaaattctgatccggatgagataaggtgtgaagtttcggatttgttctatcatgtc
ttagtgatgttggaagagcgaggggtcagcgtagaagaagttagcagagaacttcttaaa
aggcgaagtaaggattag

DBGET integrated database retrieval system