KEGG   Desulfosporosinus meridiei: Desmer_1594
Entry
Desmer_1594       CDS       T02207                                 

Definition
(GenBank) pyrrolysine biosynthesis protein PylD
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00300  Lysine biosynthesis
dmi01100  Metabolic pathways
dmi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dmi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Desmer_1594
Enzymes [BR:dmi01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     Desmer_1594
SSDB
Motif
Pfam: AlaDh_PNT_C Shikimate_DH 2-Hacid_dh_C AdoHcyase_NAD Pyr_redox_2 NAD_binding_7 Staph_opine_DH 3HCDH_N Pyr_redox Pyr_redox_3 ThiF HI0933_like
Other DBs
NCBI-ProteinID: AFQ43574
UniProt: J7ITT4
LinkDB
Position
1663912..1664745
AA seq 277 aa
MTRLKHEDVVEIPTTLEDYDQQLIDKTGCSLKELAARAAGLQANIEVNQLQLKVAVIPMS
CGQGIIEGFAESVTGIISYLGFKALTTKSWDAGGVAEAIQEGAEVLFMADDERFVAVNVR
TGKVSDNGDATGRGYAVGLERMSNGLEGKKVLVIGAGPVGVGAAIALAGFRAEVGVYDIV
SASSERLQENLRRLGYRVTIETDLNAALNHYQNIVDACPAENIILLEHITENTRIAAPGI
PLGVQADGLKKVSTRLLHDPLHIGVGTMMFDVLIDSL
NT seq 834 nt   +upstreamnt  +downstreamnt
ttgacaagactaaagcacgaagacgttgtagaaattcctacaacactagaagactatgac
caacaattgattgataaaacaggttgttcgctgaaagagcttgctgcgagagcagcagga
cttcaagctaatatcgaagtgaaccagcttcaactaaaagtagctgtaattcccatgtct
tgtggtcaaggaataattgaggggtttgcggaatctgtaaccggaataatcagctatctg
ggctttaaggcgttaacgactaagagttgggatgccggtggggttgcggaggcaattcaa
gagggcgcggaagtgttatttatggcagatgatgaacgttttgttgcagtcaatgtgcgt
accggtaaggtctctgacaatggcgatgctaccggtagaggatatgctgttggacttgag
cgaatgagtaatggattagaaggtaaaaaagttttagtgatcggggctggtccagttggt
gtaggggcagctattgccctggccggtttccgggcagaagttggagtttatgacattgtg
agtgcatcaagcgaaagactccaagagaatttaagaaggctcgggtatagggtaactatc
gagactgatttaaatgctgccttaaaccattatcaaaacatagttgatgcttgtcctgct
gaaaatatcattttattggaacatatcactgaaaatacgaggattgcagctcccggtata
ccccttggtgtccaggctgacggtctgaaaaaggtctcgacaagattactacatgacccc
ctgcatataggcgtaggaaccatgatgtttgatgtactaatagatagtctttga

DBGET integrated database retrieval system