KEGG   Desulfosporosinus meridiei: Desmer_2255Help
Entry
Desmer_2255       CDS       T02207                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00040  Pentose and glucuronate interconversions
dmi00051  Fructose and mannose metabolism
dmi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Desmer_2255
   00051 Fructose and mannose metabolism
    Desmer_2255
Enzymes [BR:dmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     Desmer_2255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C Sacchrp_dh_NADP NAD_binding_3 TrkA_N ADH_N_2 2-Hacid_dh_C DapB_N
Motif
Other DBs
NCBI-ProteinID: AFQ44191
UniProt: J7IZP7
LinkDB All DBs
Position
2371840..2372880
Genome map
AA seq 346 aa AA seqDB search
MKNRAAYMTGLNKMEIREIKVPVPKEKQVLVKLEYVGICGSDVHYLEHGKIGDFVVNGDF
ILGHECAGIVESVGPGVENLKVGDRVALEPGITCGQCEFCKSGRYNLCPDVEFLATPPYH
GCLMNYIAFPENMAFKLPESISTKEGALVEPLAVGMHAAKQGDVKLGDSVVILGSGTIGL
VTLLACKAFGATDITVVDVIPKRLEYAKKLGATTVLNATEVDVLAEIDKLTNKKGVDIVI
ETAGSAQTIAQTPYLIKNGGRIVLVGMAPQDIIEYNIAKVLAKEAEIKSVFRYRNIYPQA
INAIAQGIIDISGIITHEFDFEDVAKAFDFVINHKQDVVKAVIKIG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatagagctgcttatatgacaggtcttaataaaatggaaatccgagaaatcaaa
gttcctgtaccaaaagaaaaacaggttcttgtcaaactcgagtatgtggggatttgcggg
tctgacgtccactatttagaacatggtaaaataggggattttgtggtcaatggtgatttt
atcttggggcatgaatgtgcgggtattgtagagtccgttggaccaggtgtagaaaatctt
aaggttggagacagagtagccttagagccggggataacttgtggtcaatgcgaattttgc
aagtccggcagatacaatctttgtccggatgtagaatttttagcgactccaccttaccat
ggctgtttaatgaactatattgccttcccggaaaatatggcctttaagctgccggaatca
atctcaaccaaagaaggcgcacttgttgagcccttagccgttggcatgcatgctgctaag
cagggtgatgttaagttgggagattcagtagtgattctcggttcaggtaccattggtctg
gttacgttgctggcgtgtaaggcctttggcgctacggatattacggttgtcgatgttatt
cctaagaggcttgaatatgctaaaaaattgggagcaaccacagttttaaatgccacagaa
gtagatgtgttagcagaaattgataaactgaccaacaaaaaaggggtcgacattgtcatt
gaaacggcaggttctgcccaaactattgctcaaaccccctatcttattaaaaatggtggg
cgtatagtgcttgtgggtatggctcctcaggatattattgaatataacatcgctaaagtc
ttagctaaagaagccgaaatcaaatccgtcttccgttatagaaatatctatccgcaagcg
atcaatgcaatagcccaagggattattgatatttcaggaattattactcatgagtttgat
tttgaggatgttgccaaggcttttgactttgtaattaaccataaacaagatgtagttaaa
gctgtgataaaaatcggctaa

DBGET integrated database retrieval system