KEGG   Desulfosporosinus meridiei: Desmer_2462Help
Entry
Desmer_2462       CDS       T02207                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00473  D-Alanine metabolism
dmi00550  Peptidoglycan biosynthesis
dmi01100  Metabolic pathways
dmi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:dmi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Desmer_2462
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Desmer_2462
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Desmer_2462
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dmi01011]
    Desmer_2462
Enzymes [BR:dmi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Desmer_2462
Peptidoglycan biosynthesis and degradation proteins [BR:dmi01011]
 Precursor biosynthesis
  Amino acid ligase
   Desmer_2462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 GARS_A
Motif
Other DBs
NCBI-ProteinID: AFQ44380
UniProt: J7IRV5
LinkDB All DBs
Position
complement(2583543..2584649)
Genome map
AA seq 368 aa AA seqDB search
MNDHKPTVVLLFGGRSGEHEVSLNSASSIYKAIDRSRYNVETIGINKQGQWFWGVIPDQI
LKTGFPTTTEGLQVTLVIDPTQPHFLAINGQSLPNDGKFDLVFPVLHGTYGEDGTLQGLL
EMANVPYVGSGVLGSSLGMDKDRMKAVFIERNLPSARYVTLLRSEFLREPETYLNKIEAQ
LGYPCFVKPANLGSSVGISKAHDRTELQESLKTAAIFDRKIVIEESINGHEIEVSVLGND
SPIASIPGEVLPAQEFYTYEAKYSNIGSSLLIPAALEDDIVKKLQLMAIQAFQAVEASGL
SRVDFFVNDENEIFLNEINTLPGFTEISMYPKLWEATGIPYTELIDRLIILGMERFQDKQ
NCKISQND
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatcacaaaccgactgtggttcttctgttcggtgggcgctctggggaacatgaa
gtttccttaaactctgcatcatcgatctacaaagcgattgacagaagtcgttataatgta
gaaacgattggtattaacaaacaagggcagtggttttggggagttataccggatcaaatt
ttgaaaacaggtttcccgacgactacggaggggttacaggtaactttagtcatcgatcct
actcaaccacatttcttggccatcaatggtcaatctttgcccaacgatgggaagtttgat
ttggttttccctgttcttcatggaacctatggggaggacggtacacttcaaggattactg
gagatggctaatgttccttatgtaggatccggagttctgggatcttctctggggatggat
aaagatcgaatgaaagctgtgttcatcgagagaaatcttccttcggcacgatatgtaact
ctgctgcgatcagagttcctgagggaacctgagacttatctgaataagattgaagctcag
ctagggtatccttgctttgttaaaccagccaatctggggtcgagcgtggggatctccaag
gctcatgatcgtacagagctccaagagtctttaaagacagccgccatttttgaccgtaaa
attgttatcgaagagtccattaacgggcatgaaatagaagtttcagtcttagggaacgat
agccctatcgcctctattccaggggaagtactaccggcccaggagttctatacttatgaa
gctaagtactccaacattggctcaagccttttaattccggcagcgctggaagacgacatc
gttaagaagttgcaacttatggccattcaagccttccaagcagttgaagctagcggctta
agtcgagttgacttctttgtgaatgatgaaaatgaaatatttcttaatgagataaatact
ctaccaggttttactgaaatctccatgtaccctaaactgtgggaagctacaggcattccc
tacactgaattaatcgatcgcttaattatcttgggtatggaacgttttcaggataaacaa
aactgtaaaatttcccagaatgactaa

DBGET integrated database retrieval system