KEGG   Desulfosporosinus meridiei: Desmer_2995
Entry
Desmer_2995       CDS       T02207                                 

Definition
(GenBank) pyrrolysine biosynthesis protein PylD
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00300  Lysine biosynthesis
dmi01100  Metabolic pathways
dmi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dmi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Desmer_2995
Enzymes [BR:dmi01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     Desmer_2995
SSDB
Motif
Pfam: Sacchrp_dh_NADP DAO ELFV_dehydrog TrkA_N Thi4 Shikimate_DH Pyr_redox_2 FAD_binding_3 F420_oxidored PglD_N
Other DBs
NCBI-ProteinID: AFQ44883
UniProt: J7J0R2
LinkDB
Position
complement(3119707..3120522)
AA seq 271 aa
MSRLLESDIDLIETQLQDYEDLFIRQTGCTMEEIAQKAVGLTVNSKRVKTAVISVTSGLG
MITGFSQAVGAILRHLRVETLIGEKTDVAGLQQAYLSKCGIAFLADDYVCAALGIGSAVH
SDNGWATGRGFAAAIIEAMRKQGINPLQERVLIIGAGPVGEAAAHYIAEQQGIPVICDLD
DNKAASLAATLDQSAWVSAPAPIRQFTYIIDAGTTGDFITAEDFTEKTILAAPGMPCGAT
VAAREKAMVIHNPLELGIITMYFDCLKQLED
NT seq 816 nt   +upstreamnt  +downstreamnt
atgtcgagactgctggaatctgatatcgatttgattgaaacacaacttcaggattatgaa
gatctgtttatcagacaaacaggctgtaccatggaggaaattgctcaaaaagcggtgggt
ttaacggtaaattcaaaaagagtcaagaccgcagtcatttccgttacgagcggactgggc
atgatcaccggattctcacaagcggtgggagccattcttcgtcatctccgggtggaaacc
ttgattggggagaaaacggacgttgccggtctccaacaagcctatctgtcaaaatgcgga
atcgcatttctggccgacgattacgtgtgcgcggccttagggattggaagtgccgtgcac
tccgacaatggctgggctacgggaaggggctttgcagcggcaatcatcgaggctatgagg
aaacaggggataaatccgctgcaggaacgggtgctgataatcggagccggcccggtggga
gaagcggcggcccattacatcgcagaacaacaggggataccggtgatctgcgatttggac
gataacaaagcggcttccttggcagcaactttagatcaatccgcctgggtttctgcgccg
gctccaatccgacagtttacctatatcatcgatgccggtaccacgggggattttattacg
gcagaagacttcaccgaaaaaacaatccttgcggcaccaggtatgccctgcggagcgacg
gttgcagccagagaaaaagccatggtaatccataatccattggagcttggcatcataacc
atgtattttgattgtctgaaacagttagaggattaa

DBGET integrated database retrieval system