KEGG   Desulfosporosinus meridiei: Desmer_3033Help
Entry
Desmer_3033       CDS       T02207                                 

Definition
(GenBank) glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00970  Aminoacyl-tRNA biosynthesis
dmi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dmi00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Desmer_3033
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dmi03029]
    Desmer_3033
Enzymes [BR:dmi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Desmer_3033
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Desmer_3033
Mitochondrial biogenesis [BR:dmi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Desmer_3033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AFQ44916
UniProt: J7J1T3
LinkDB All DBs
Position
complement(3164595..3166043)
Genome map
AA seq 482 aa AA seqDB search
MVVANKYEMVCGLEVHVELQTKTKIFCGCTTEFGGDQNTHVCPVCLGMPGALPVLNREVV
DYAIKAGLALNCEIAEFSKFDRKNYFYPDLSKNYQTSQFDLPICGKGGLEIEVEGEKKWI
GITRAHMEEDAGKLVHSGDTITTSNASSVDYNRAGVPLLEIVSEPDMRSIPEVLAYLEKL
VQILEYTEVSDCRMEQGSVRFDINVSLRPIGETAFGTRTETKNLNSFSSVRRCMEYEIAR
QARVLDAGEKVVQETRTWDEGQGITLALRSKEEAHDYRYFPEPDLTPLIIDREWVERIRQ
TLPELPAQRRARLQGIGLSEYDAGVITQSKSLSDFFDAALESFGDAKTLANWVMGDVMRL
LNSNQCPVEDSPISPKQLAELLELIEKGTISGKIAKTVLEEMYATGKDAQVIVKEKGLAQ
ISDEGALLGIIDGVLAANPQSVEDYRAGKDRAIGFLVGQIMKATKGQANPGLVNRLLKEK
LS
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtggtagtcgctaataaatatgaaatggtttgtggactggaagttcacgtagaactccag
accaagactaagattttttgcgggtgtacaacagagttcggaggagaccaaaacactcac
gtctgcccggtctgcttaggcatgcccggtgcccttccggtactaaatcgtgaagtagtg
gattacgccatcaaagccggtttagccttgaattgtgagatcgccgaattctcgaagttc
gacagaaagaactatttctatcccgacttgtctaagaactaccaaacctctcagttcgat
ttacccatttgcggtaaaggcggcttagagattgaagtggagggcgagaaaaaatggatt
gggattactcgggcccacatggaggaagatgcgggtaagctcgtccatagcggagatacc
atcacaacctctaatgcttcctccgttgactataaccgagcgggagtccccctcttggaa
atcgtatccgagccggatatgcgttcaatcccggaagttctggcttacttggaaaaatta
gtgcaaatcttagagtatacggaagtctcggattgtcggatggaacaaggttctgtgcgc
tttgatattaatgtctccttgcgtcccataggagagacagccttcggaactcgtactgag
acaaagaacttaaactctttcagctccgtacggcgctgtatggaatatgaaatagcccgg
caagcaagagtgttagatgccggtgaaaaagtggtacaagagacaaggacttgggatgag
ggtcaagggattaccttagccttacgctccaaggaagaagctcatgattaccgctatttc
ccggaaccggacctaacaccccttataattgatcgagaatgggtggaacgaattcgccaa
accctgcctgagcttccggcacaacgacgggctcggctgcaaggcataggattatctgag
tacgatgccggggttatcacccaatccaaatccttgtctgacttctttgatgctgcactt
gaaagcttcggcgatgctaagaccttagcgaactgggtgatgggagatgttatgcgtctg
ctgaattccaaccagtgtccagtcgaggattctcccatttctcccaagcagttagcggaa
ttattagagctgatcgaaaaaggaaccatcagcggcaaaatagctaagacagttctcgaa
gaaatgtacgccaccggcaaggatgcccaggtgatcgttaaggaaaaagggcttgctcaa
atcagtgatgaaggggccttactgggaattatcgacggcgtcctggccgctaatcctcaa
tccgtggaggactaccgcgccggcaaagatcgagccattggctttttagtcggacagatc
atgaaagccaccaagggtcaggcgaatccgggtcttgtcaatcgattgctgaaggaaaaa
ctatcttaa

DBGET integrated database retrieval system