KEGG   Desulfosporosinus meridiei: Desmer_3770Help
Entry
Desmer_3770       CDS       T02207                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
dmi  Desulfosporosinus meridiei
Brite
KEGG Orthology (KO) [BR:dmi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dmi01001]
    Desmer_3770
Enzymes [BR:dmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Desmer_3770
Protein kinases [BR:dmi01001]
 Serine/threonine kinases: Other
  Bacterial family
   Desmer_3770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kdo APH RIO1 Kinase-like YrbL-PhoP_reg Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: AFQ45606
UniProt: J7J3P8
LinkDB All DBs
Position
complement(3923616..3925400)
Genome map
AA seq 594 aa AA seqDB search
MSKIFGGRYEVLERIGAGGMAIVYKAKDLLLNRVVTIKVLREQFVTDEDFIRRFRREAQS
AASLSHPNIVSIYDVGKDGDTEYIVMEFVEGRNLKEIIREYAPLSTEQSINLARQITGAI
QNAHENHIIHRDIKPHNILVTADGHAKVTDFGIARAVSSATVTHTGDIVGSVHYLSPEQA
KGIQSNEQSDIYSLGIVLYELLTGKVPYDGETPIAIALKHLQQEPLPPSKLNPRITKDFE
AVIMRAIAKMPEKRYLSAKELLEDLNRIQAGQPIEWFGLFPEDDPEATRTHQGMGRALAS
IDVKDSAANKPNDNLNNKRKFWIIGGLVLLFVLVGGGLWLKNFISVESTKVPDLAGKTVP
VAEDYLKQAELVRDPEITYEFNDKVEKDRIISQDPEAESLVKVGRAIKLTVSKGIDMGQF
PDVKTGNMSKEHALNLIQNAGFTGEITFVPVPDANLPKDAVIDQNPMPKASWPKNGNITL
TISVGPQWQTINMPNVIGRSSAEAKTILQDQNRLILKIETEGSNTYPVDVVIRTTPNPGE
SIQQGSEVNVVVSSGPGPLAQGMFDQASNSKVMLAQSLSRFFNVIIPNSMVSEE
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcttcgggggacgatacgaggttttagagagaattggagccggtggaatg
gcgattgtttacaaggctaaggatcttttacttaaccgcgttgtgactatcaaggttctc
cgagagcagtttgtaacagatgaagactttattcgtcgttttcggagggaagctcagtct
gctgctagcttgtctcaccccaacattgtgtcaatatatgatgtgggtaaagacggagat
acagaatacattgtcatggaatttgtggaaggtcgtaatcttaaagagattattcgtgaa
tatgcgcctctttccacagagcaatctattaatcttgcccgtcaaataacaggtgctatt
caaaatgctcatgaaaatcatattattcatcgggatattaagccccacaacatattagtc
accgcggacggacatgctaaagtaacggatttcggtattgctcgagccgtatcttcagct
actgttacgcatactggagatattgttggttcagttcattatttgtcaccggaacaagct
aaaggaattcaaagcaatgaacaatctgacatatattctctgggaatcgtgctctatgaa
cttttaacgggtaaagtgccctatgatggtgaaactcctatcgctatagcgttaaagcac
ttacaacaggagccccttcccccgagtaagcttaaccctcggatcacaaaagacttcgaa
gcggtcattatgcgggcgattgccaagatgccagagaaaaggtatttgtcagctaaagaa
ttacttgaagatctaaaccgtattcaagctgggcagcccattgagtggtttggacttttt
ccagaggatgatccggaagcaacaaggactcatcaagggatgggcagggctctggcatca
attgatgtaaaggactctgcagcgaataagcccaacgataatcttaataataaacgtaag
ttttggattattggcggccttgtacttctctttgtcttagttggcggagggctttggtta
aaaaattttatttcggtggagtctacaaaggttccggacttagcaggtaaaactgttcct
gttgccgaggattatttaaaacaggccgaattagttcgtgatccggagattacctatgag
tttaatgataaagttgaaaaggatcgaatcatttcccaggatcctgaagcggaatcctta
gttaaggttggcagggctataaaacttactgttagtaaagggatcgatatggggcaattt
cctgatgtaaaaacaggaaatatgtcaaaggaacatgctttaaatctcattcaaaatgcc
ggttttaccggcgaaataacatttgtgcctgtgccggatgctaatctgccaaaagatgca
gtcattgatcagaatccgatgcccaaagcttcttggcctaaaaatggtaatattacttta
actatcagcgtgggcccccaatggcagaccatcaatatgcccaatgttataggtcggtca
tctgctgaagcgaaaaccatacttcaggatcagaataggctgattttgaagattgagact
gaaggatctaatacctacccagtagatgttgtgataagaacgacacctaacccgggggaa
agtattcaacagggttcggaggtcaatgtggttgtctcgagtgggccgggtccattggct
caaggaatgtttgatcaagctagcaacagcaaggtaatgttggctcagtctttatcaaga
tttttcaatgttatcatccccaactcaatggtcagtgaggaatag

DBGET integrated database retrieval system