KEGG   Desulfosporosinus meridiei: Desmer_3825Help
Entry
Desmer_3825       CDS       T02207                                 

Definition
(GenBank) glycine cleavage system T protein
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
dmi  Desulfosporosinus meridiei
Pathway
dmi00260  Glycine, serine and threonine metabolism
dmi00630  Glyoxylate and dicarboxylate metabolism
dmi00670  One carbon pool by folate
dmi01100  Metabolic pathways
dmi01110  Biosynthesis of secondary metabolites
dmi01130  Biosynthesis of antibiotics
dmi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Desmer_3825
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Desmer_3825
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Desmer_3825
Enzymes [BR:dmi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Desmer_3825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C SoxG
Motif
Other DBs
NCBI-ProteinID: AFQ45661
UniProt: J7J3W5
LinkDB All DBs
Position
complement(3983499..3984611)
Genome map
AA seq 370 aa AA seqDB search
MNELKRTPLYEEHLAHKAKLIDFGGWEMPVQYVGVIDEHHAVRTKAGLFDVSHMGEIEVR
GQDALEFIQMLITNDVSKLEDGRILYSPMCYPSGGIVDDLLVYRYNSQHFLIVVNASNTD
KDYAWILKQADSFNVNLGNVSDQYAQLALQGPLAETVLQRITELNLSQIKYYSFTHGNID
GISCLVSRTGYTGEDGFEIYVTPEHSRQLWRKILEVGALEGVQPIGLGARDTLRFEARLP
LYGNELGAEISPLEAGLGIFVKLDKVNFIGKEVILAQKEQGVPRKLVGLEMIERGIARSH
YPLQKDGQEIGFVTSGSFSPTLNKNIALGLVKADLAIQGQILDVMIRGKAVKARIVPSLF
YKREDQSKPK
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaattaaaacgcactccactttacgaagagcatttggctcataaggcaaaactt
attgattttggcggatgggaaatgcctgttcaatatgttggtgttatagatgaacatcat
gccgttcggactaaggccggccttttcgatgtgtctcatatgggtgagatagaggttcgt
ggtcaagatgctttagagtttattcaaatgctgatcacgaatgatgtcagtaagctggaa
gatggcagaattctatactctcctatgtgctatccaagcggtggaattgtggatgacttg
ttggtttatcgatataattctcaacattttctgattgttgtaaatgcctccaataccgat
aaggactatgcttggatattaaaacaagcagacagttttaatgtgaacttagggaatgtc
tctgaccaatatgctcagcttgccttacaaggtcctctagcggaaactgtcttacagcgt
attacagaacttaatctttcacagattaaatactatagtttcactcacgggaatattgac
gggattagttgtctggtttcccggacgggctatacaggagaagacggatttgagatttat
gttactcctgaacatagtcggcaactgtggagaaaaatattggaagttggtgctctagag
ggtgtacagccgattgggctgggtgcacgtgacacattgcgctttgaagctcgtcttccg
ttatatgggaatgaattaggagcggagatttctcctcttgaagctgggcttggaattttt
gttaagctagataaggtgaattttattggcaaggaggtaattctcgctcaaaaagaacaa
ggtgtaccgcgaaagttagtaggattagaaatgattgaacgtggaatagcccgttcccac
tatcccttacaaaaagatgggcaagagattggatttgttacatctggctcattttcacca
actctaaacaaaaacattgctttaggattagtcaaggccgatttagcgattcagggtcag
attcttgatgtaatgatccgtggaaaagcagttaaagcaagaattgttccctccttgttt
tataaacgtgaggatcaatcaaaacccaagtaa

DBGET integrated database retrieval system